1. Notes: 1735 / 7 hours ago  from sexdrugspinkblonde (originally from babesnevergetenough)
    daddyspainslutbunny:





๐Ÿ’–

that’s why pigtails!

    daddyspainslutbunny:

    ๐Ÿ’–

    that’s why pigtails!

     
  2. Notes: 233 / 14 hours ago  from boundballet (originally from autumnalmutterings)
    odelys:

Vote for Andrea Neal

love those mittens

    odelys:

    Vote for Andrea Neal

    love those mittens

    (Source: autumnalmutterings)

     
  3. Notes: 81 / 15 hours ago  from xxxtoonsxxx (originally from 1337beat)
    So that’s what went on with that beast…

    So that’s what went on with that beast…

    (Source: 1337beat)

     
  4. Notes: 577 / 1 day ago  from sadistic-nice-daddy (originally from the-dark-basement)
    whoreswillbewhoreswillbewhores:

No, you aren’t supposed to talk into it…

Auditioning for a position in the office

    whoreswillbewhoreswillbewhores:

    No, you arenโ€™t supposed to talk into itโ€ฆ

    Auditioning for a position in the office

    (Source: the-dark-basement)

     
  5. Notes: 1042 / 1 day ago  from painslutx (originally from whiterabbit0117)
     
  6. Notes: 196 / 1 day ago  from sexdrugspinkblonde (originally from the-women-of-eden)
    ahhpigtailgirls:

Remember that proper behaviour is required while on campus!!

These two are being trained as a lesbian pair. They will eventually be sold together.

    ahhpigtailgirls:

    Remember that proper behaviour is required while on campus!!

    These two are being trained as a lesbian pair. They will eventually be sold together.

    (Source: the-women-of-eden)

     
  7. Notes: 356 / 2 days ago  from marriedbuthere (originally from super-lagum)
    ahh… still on my someday list. Someday I’ll make my wife wear these

    ahh… still on my someday list. Someday I’ll make my wife wear these

    (Source: super-lagum)

     
  8. Notes: 477 / 2 days ago  from lipstixxx
  9. Notes: 73 / 2 days ago  from takeitslut
    pretty!

    pretty!

     
  10. Notes: 71 / 3 days ago  from mind-effing (originally from rubberdollowner)
    mind-effing:

Rubber kiss

    mind-effing:

    Rubber kiss

    (Source: rubberdollowner)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

labialoungechilxgirlswhoswallowboundballetjaythegremlinstewardessesandassortedothersfuckyeahanalfacegretchenmusingsfetish4altpornhotlatexoutfitsworkaholicatrestlightworshiptsypkineverydaycollarssensualhumiliationpainslutxgettingbusyintheofficesubmissive-monarchffncollectordailypornohappybdsmdumbbigtittedslutdr-tarlropebondagealexintheaislemind-effingkinkydaykindlybeatingherjustnippleclampsher-masterakinkygentxxxtoonsxxxcreamfaceslipstixxxstaffsainttriniansfuckyeahfrenchmaidsslaveshousenightsmutgenre-bdsm-kinkyfitandfetishheeladvisedawesomegapesandanalinsertionsdeepanaldildoacademyfordifficultgirlsmywifetheslutfilthyzensoredanalmom69mm-happypeselectrotrooper505basetliensmochavanillalattemarriedbutherebdsmbendmeoverlacemepicmanbdsmbondageloverjoinmilehighclubcuriously-shy-slutschoolgirlsonwoodstairsbimbosminderglovedandboundnettersklavekousokusuckitbimbodonebutwitherrorsonpagefuckyeahbuttplugsbondagedreamdoyoulikethat-slutgaggedkissingbdsm69fetishweeklyecstasyinrestraintsonly-secretariesindetentionlibraryvixentaroid5infernanalsomefetishesdollkinkyhot-uniform-milfslavetrainingserasedmaphourglass-silhouettenankingdecadefacesofanalsmaster667theporcelainlakerealashleyreneeaslikeasssadisticgameschloecumslutnomdegsubmissivegingergaggedandforeverboundslavepetsantiquerestbiffjr99felixdartmouthanothersecretfetishmaxlatenfemaledenialdiederiqsmaidspuppygirlsnplaythingsbendingsubmissionsluttybunnywanderer-of-dark-dreamssoupergirlstrictworldfaye6vysovenfap-labshinyretrostingysexnotsexsubmissivenikkinaughtycinderellaaryehpridebighappyfacewearegoingtohellslavegardentocamusicaair-tripthetamingofaslutjstbdsmfuckmakerdtnhbdthe-mouth-of-the-goddesskneelbegcrawlbackseamextremekneel4himdaddysbrokengirlheathen-pleasuresfuckyeahballgagsgingerbellesbedroomsubjuanitaninaninetafuck-n-fight-clubnylonfoxielostlittlesubropeculturestuffitinmemodfetishyesdaddyrapedollieangelinadanaewhisperingonly-ball-gagstransformhersimplewishesdementedkittenmr-s000-xxxthingsiddotoyouslaveelliesundash22fluffyropesundercoverkinksterpigtailprincesstroisiemebringonxtoyspolaritiessmutilovefetishphotosshinoatdarkalittlespicyiambic9sunnycuntdoorstomanualnametobedeterminedariannaacquiescesvoluntarytourettesnymphomaniac-fantasiaeditorforaweekcollaredprincesscabernetsauvignonzebraspornartofpornbarcodedbitchthesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreyharlettedaisysubdolldressedvisitingsodomfeckfeckfeckfrenchmaidsweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr