1. Notes: 205 / 9 hours ago  from nastynymphosluts
    nastynymphosluts:

This is how a nympho slut reacts to getting a surprise booty call from her favorite ass-fucker.

Tartan skirts look nice on nasty nympho sluts

    nastynymphosluts:

    This is how a nympho slut reacts to getting a surprise booty call from her favorite ass-fucker.

    Tartan skirts look nice on nasty nympho sluts

     
  2. Notes: 1002 / 1 day ago  from girlswhoswallow (originally from rockhardnsoakingwet)

    girlswhoswallow:

    you complete me

    - girlswhoswallow ⇋ dix752

    Impressive!

    (Source: rockhardnsoakingwet)

  3. Notes: 1 / 1 day ago 

    2500!!

    Yes! 2500 followers. Not much by some standards but for a little tumblr blog like mine I think it’s a good number.

    My 2500th is: mochavanillalatte who’s got a nice collection of fucking pictures. So, head over, have a look and congratulate him!

  4. Notes: 923 / 2 days ago  from extremesadistic (originally from violentlyandpassionate)
    extremesadistic:

justa a hole

I know someone who would look good in this

    extremesadistic:

    justa a hole

    I know someone who would look good in this

    (Source: violentlyandpassionate)

     
  5. Notes: 1452 / 2 days ago  from chilx (originally from lipstixxx)

    theirlittledoll:

    fetishkitsch:

    lipstixxx:

    See the full video at FetishKitsch or follow their Tumblr!
    View more Lipstixxx gifs

    Thanks Lipstixxx! 

    Two rubber dolls at play

    YUM!

  6. 2 days ago  from bookmarklet
    Something for my female followers? It vibrates, is small so there’s always room in your luggage for it , it’s waterproof and it has 8Gb storage so you can take your favourite porn with you.

    Something for my female followers? It vibrates, is small so there’s always room in your luggage for it , it’s waterproof and it has 8Gb storage so you can take your favourite porn with you.

     
  7. Notes: 770 / 3 days ago  from girlswhoswallow (originally from hatefuckingforbeginners)
    girlswhoswallow:

ideal career advancement strategy
- girlswhoswallow ⇋ wetfestish

    girlswhoswallow:

    ideal career advancement strategy

    - girlswhoswallow ⇋ wetfestish

    (Source: hatefuckingforbeginners)

     
  8. Notes: 1 / 3 days ago 
    Only one more!!! Who will it be?!

    Only one more!!! Who will it be?!

     
  9. Notes: 42 / 4 days ago  from chilx (originally from spank-slap-repeat)
  10. Notes: 25 / 4 days ago  from jaythegremlin
    pretty!

    pretty!

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

her-masterpainslutxropebondagedailypornogenre-bdsm-kinkyfetish4nankingdecadeeverydaycollarsworkaholicatrestpicmanbdsmdonebutwitherrorsonpagejaythegremlinbdsmalexintheaisleecstasyinrestraintstsypkingettingbusyintheofficesubmissive-monarchsubmissivegingerdollkinkysensualhumiliationmind-effingbdsm69girlswhoswallowjustnippleclampsacademyfordifficultgirlslipstixxxffncollectorakinkygentstewardessesandassortedothersdr-tarlxxxtoonsxxxdumbbigtittedslutjoinmilehighclubheeladvisederasedmapnettersklavemm-happybimbosminderlabialoungetrooper505chilxaltpornvysovensadisticgameshappybdsmdoyoulikethat-slutcreamfacesmochavanillalattestaffglovedandboundfuckyeahfrenchmaidsslaveshousebondagedreamfuckyeahanalfacefaye6lightworshipsuckitbimbogretchenmusingsdeepanaldildostrictworldawesomegapesandanalinsertionsmywifetheslutslavetrainingsfitandfetishlibraryvixenbasetliensgaggedandforeverboundbighappyfaceanalmom69fetishweeklykindlybeatingherlacemefap-labsexnotsexmarriedbuthererealashleyreneefemaledenialkousokusainttrinianswearegoingtohellbendmeoverbondageloversomefetishesanothersecretfetishnightsmutonly-secretariestheporcelainlakemaxlatenslavegardensoupergirlhourglass-silhouetteantiqueresttaroid5boundballetfuckyeahbuttplugspuppygirlsnplaythingsshinyretrostingypeselectroaryehpridekinkydayaslikeasstocamusicabendingsubmissionair-tripfacesofanalthetamingofaslutsluttybunnycuriously-shy-slutnomdegnaughtycinderellaschoolgirlsonwoodstairsgaggedkissingjstbdsmsubmissivenikkifuckmakerslavepetschloecumslutindetentiondtnhbddiederiqsmaidsthe-mouth-of-the-goddesskneelbegcrawlbackseamextremewanderer-of-dark-dreamskneel4himsmaster667daddysbrokengirlheathen-pleasuresfuckyeahballgagsgingerbellesbedroomsubjuanitaninaninetafuck-n-fight-clubnylonfoxielostlittlesubropeculturebiffjr99infernanalfilthyzensoredstuffitinmemodfetishyesdaddyrapedollieangelinadanaewhisperingonly-ball-gagstransformhersimplewishesdementedkittenmr-s000-xxxthingsiddotoyouslaveelliesundash22fluffyropesundercoverkinksterpigtailprincesstroisiemebringonxtoyspolaritiessmutilovepony-girl-elisa-solonsdottirfetishphotosshinoatdarkalittlespicyiambic9sunnycuntdoorstomanualnametobedeterminedariannaacquiescesvoluntarytourettesnymphomaniac-fantasiaeditorforaweekcollaredprincesscabernetsauvignonzebraspornartofpornbarcodedbitchthesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreyharlettedaisysubdolldressedvisitingsodomfeckfeckfeckfrenchmaidsweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr