1. Notes: 44 / 2 hours ago  from smaster667 (originally from biffjr99)
    bubbadsm:

found this here: http://biffjr99.tumblr.com

Clever way to keep her head in position

    bubbadsm:

    found this here: http://biffjr99.tumblr.com

    Clever way to keep her head in position

     
  2. 6 hours ago  from bookmarklet
    Just having a serving wench

    Just having a serving wench

     
  3. Notes: 1 / 9 hours ago  from bookmarklet
    "I’m just opening her hole for you darling"

    "I’m just opening her hole for you darling"

     
  4. Notes: 1 / 13 hours ago  from bookmarklet
    Her prince could reach places the dwarves never could

    Her prince could reach places the dwarves never could

     
  5. Notes: 1 / 22 hours ago  from bookmarklet
    Lara needs some relaxation

    Lara needs some relaxation

     
  6. Notes: 2 / 1 day ago  from bookmarklet
    "there’s 7 of you, who wants to go first?"

    "there’s 7 of you, who wants to go first?"

     
  7. Notes: 1 / 1 day ago  from bookmarklet
     
  8. 1 day ago  from bookmarklet
    A thumb in the ass is fun for steering her

    A thumb in the ass is fun for steering her

     
  9. Notes: 2 / 1 day ago  from bookmarklet
     
  10. Notes: 3 / 1 day ago  from bookmarklet
    That;s a big ass!

    That;s a big ass!

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

mm-happyhotlatexoutfitsakinkygentropebondageeverydaycollarssadisticgamesworkaholicatresttsypkindailypornojaythegremlinbondageloverboundballetgirlswhoswallowmaxlatengettingbusyintheofficesubmissive-monarchxxxtoonsxxxfetish4sensualhumiliationfelixdartmouthem56dumbbigtittedslutlabialoungepainslutxnettersklavedr-tarlffncollectornightsmutcreamfacesvysovenslavetrainingsacademyfordifficultgirlsmywifetheslutsomefetishestheporcelainlakeanalmom69justnippleclampsdiederiqsmaidsnastynymphoslutstrooper505thetamingofabeastgenre-bdsm-kinkyfemaledenialher-masterkinkydaykindlybeatinghermind-effingsuckitbimbomarriedbutherechilxdoyoulikethat-slutpicmanbdsmmodfetishlacememochavanillalattefuckmakerstewardessesandassortedothersecstasyinrestraintshourglass-silhouettejoinmilehighclubcuriously-shy-slutschoolgirlsonwoodstairsaltpornsubmissivegingerheeladvisedalexintheaisleantiquerestlightworshiplibraryvixennomdegaslikeassfuckyeahanalfacelipstixxxsmaster667fuckyeahbuttplugspeselectrobimbosminderawesomegapesandanalinsertionsanothersecretfetishstafferasedmapstrictworlddeepanaldildoslaveshousehappybdsminfernanalglovedandboundrealashleyreneefetishweeklybendingsubmissionsexnotsexbdsmjstbdsmgaggedandforeverboundfitandfetishmymilkweedindetentiondollkinkynaughtycinderellachloecumslutsainttriniansbdsm69air-tripslavegardenslavepetsdonebutwitherrorsonpagekousokubasetlienstransformhernankingdecadebendmeoverfap-labheathen-pleasuresfuckyeahfrenchmaidsfuckyeahballgagsfaye6only-secretariesgretchenmusingsgingerbellesbedroomsluttybunnywanderer-of-dark-dreamssubmissivenikkibackseamextremefacesofanaltaroid5shinyretrostingybiffjr99bondagedreamgaggedkissinghot-uniform-milfpuppygirlsnplaythingssoupergirlaryehpridebighappyfacewearegoingtohelltocamusicadtnhbdthe-mouth-of-the-goddesskneelbegcrawlkneel4himdaddysbrokengirlsubjuanitaninaninetafuck-n-fight-clubnylonfoxielostlittlesubropeculturestuffitinmeyesdaddyrapedollieangelinadanaewhisperingonly-ball-gagssimplewishesdementedkittenmr-s000-xxxthingsiddotoyouslaveelliesundash22fluffyropesundercoverkinksterpigtailprincesstroisiemebringonxtoyspolaritiessmutilovefetishphotosshinoatdarkalittlespicyiambic9sunnycuntdoorstomanualnametobedeterminedariannaacquiescesvoluntarytourettesnymphomaniac-fantasiaeditorforaweekcollaredprincesscabernetsauvignonzebraspornartofpornbarcodedbitchthesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreyharlettedaisysubdolldressedvisitingsodomfeckfeckfeckfrenchmaidsweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr