1. Notes: 40 / 3 hours ago  from cfnmfetish
    cfnmfetish:
Send to his hotelroom to drop of some documents

    cfnmfetish:

    Send to his hotelroom to drop of some documents

     
  2. Notes: 159 / 9 hours ago  from nanotesseract
    I neveer did care much for chains since my wife gets cold so easily. However seeing this…..

    I neveer did care much for chains since my wife gets cold so easily. However seeing this…..

     
  3. Notes: 270 / 22 hours ago  from droolingdamsels (originally from fetishkitsch)
    fetishkitsch:

Hard to even sit on the bed with this much locking metal and restraint.  Check it out on the new update to FetishKitsch.com
Hood and Restraints by LatexNemesis | Catsuit by FantasticRubber

imagine how sweaty she’ll get

    fetishkitsch:

    Hard to even sit on the bed with this much locking metal and restraint.  Check it out on the new update to FetishKitsch.com

    Hood and Restraints by LatexNemesis | Catsuit by FantasticRubber

    imagine how sweaty she’ll get

     
  4. Notes: 31 / 1 day ago  from droolingdamsels (originally from fh-bdsm)
    fh-bdsm:

Click here and hook up sexy girls from your area !

She kept saying she wasn’t a lesbian so she needs a ring gag for her first lesson in girl on girl

    fh-bdsm:

    Click here and hook up sexy girls from your area !

    She kept saying she wasn’t a lesbian so she needs a ring gag for her first lesson in girl on girl

     
  5. Notes: 915 / 1 day ago  from droolingdamsels (originally from slutsheads)
    Get some spit on your thumb and start rubbing those nipples while you hold a vibrator on her clit

    Get some spit on your thumb and start rubbing those nipples while you hold a vibrator on her clit

    (Source: slutsheads)

     
  6. Notes: 55 / 1 day ago  from tinybondage (originally from boundgaggedfucked)
    "no miss Jones, the office dress code clearly states 3 inch heels at least"

    "no miss Jones, the office dress code clearly states 3 inch heels at least"

    (Source: boundgaggedfucked)

     
  7. Notes: 206 / 2 days ago  from droolingdamsels (originally from bondagecafe)
    bondagecafe:

@KendraJames13 is up in the archives this week on www.bondagecafe,com. She’s wet and ready for action. Yummy! #latex #bondage #wet

wauw!

    bondagecafe:

    @KendraJames13 is up in the archives this week on www.bondagecafe,com. She’s wet and ready for action. Yummy! #latex #bondage #wet

    wauw!

    (Source: bondagecafe.com)

     
  8. Notes: 292 / 2 days ago  from ffncollector (originally from realashleyrenee)

    ffncollector:

    realashleyrenee:

    Living Doll .. Watch Ashley Renee transform from girl next door to a Living Doll that’s forced to orgasm while tied up in latex!

    Rubber Doll Ashley Renee …. more in her  website : www.ashleyrenee.com

    what’s not to like?

  9. Notes: 1 / 2 days ago  from bookmarklet
    extra schoolgirl training

    extra schoolgirl training

     
  10. Notes: 2360 / 3 days ago  from zonelux (originally from fetishgifs)
    zonelux:

fetishgifs: 

Something to watch during an hour long teleconference. His secretary strolling with a big plug up her ass.

    zonelux:

    fetishgifs

    Something to watch during an hour long teleconference. His secretary strolling with a big plug up her ass.

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

tsypkinveronicasviewboundballetdailypornopainslutxworkaholicatrestcreamfaceshotlatexoutfitsnastynymphoslutsgirlswhoswalloweverydaycollarsakinkygentfetish4dumbbigtittedslutsensualhumiliationsubmissive-monarchlabialoungefitandfetishffncollectorjoinmilehighclubtheporcelainlakeecstasyinrestraintsbondageloverbondagedreamacademyfordifficultgirlsmywifetheslutgenre-bdsm-kinkysomefetishesdeepanaldildoslavepetsher-masterzoneluxnightsmutkneelbegcrawlnankingdecadenomdegem56mind-effingropebondagefuckyeahanalfacefetishweeklyantiquereststaffsuckitbimbolightworshiptrooper505analmom69gettingbusyintheofficelacemelipstixxxsmaster667mochavanillalattesubmissivegingergaggedandforeverbounddr-tarlcuriously-shy-slutschoolgirlsonwoodstairsstewardessesandassortedothersaltpornhappybdsmrealashleyreneelibraryvixenbdsm69heeladvisedinfernanalslaveshousesainttrinianssubmissivenikkimaxlatendoyoulikethat-slutslavetrainingsnettersklavejustnippleclampsindetentionsadisticgamesmm-happythetamingofabeastpicmanbdsmkinkydaydiederiqsmaidstransformherchattelprodstrictworldmaidsatschoolerasedmappeselectrodonebutwitherrorsonpagekindlybeatingherchilxmarriedbutherewanderer-of-dark-dreamsgaggedkissingbdsmthingsiddotoyoucumstarvedpuppygirlsnplaythingsalexintheaisledroolingdamselsair-triphourglass-silhouettedollkinkyglovedandboundjstbdsmslavegardenthe-mouth-of-the-goddessfuckyeahfrenchmaidsawesomegapesandanalinsertionsfemaledenialnaughtycinderellaanothersecretfetishfacesofanalaslikeassyesdaddychloecumslutthelingerielesbianonly-secretariesfuckyeahbuttplugsgretchenmusingsfap-labfelixdartmouthbendingsubmissionbimbosmindersexnotsexwearegoingtohellkousokubiffjr99mymilkweedvysovenbendmeoverfuckmakermodfetishbasetliensheathen-pleasuresfuckyeahballgagsfaye6gingerbellesbedroomsluttybunnybackseamextremetaroid5shinyretrostingyhot-uniform-milfsoupergirlaryehpridebighappyfacetocamusicadtnhbdkneel4himdaddysbrokengirlsubjuanitaninaninetafuck-n-fight-clubnylonfoxielostlittlesubropeculturestuffitinmerapedollieangelinadanaewhisperingonly-ball-gagssimplewishesdementedkittenmr-s000-xxxslaveelliesundash22fluffyropesundercoverkinksterpigtailprincesstroisiemebringonxtoyspolaritiessmutilovefetishphotosshinoatdarkalittlespicyiambic9sunnycuntdoorstomanualnametobedeterminedariannaacquiescesvoluntarytourettesnymphomaniac-fantasiaeditorforaweekcollaredprincesscabernetsauvignonzebraspornartofpornbarcodedbitchthesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreyharlettedaisysubdolldressedvisitingsodomfeckfeckfeckfrenchmaidsweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr