1. Notes: 6 / 3 years ago  from bookmarklet
    I like pink!
via galleries.disgraced18.com

    I like pink!

    via galleries.disgraced18.com

     
  2. Notes

    1. bigjaysfavs posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

xxxtoonsxxxmm-happygirlswhoswallowboundballetjaythegremlinmind-effingstewardessesandassortedothersfitandfetishbdsm69kindlybeatinghersensualhumiliationgenre-bdsm-kinkyfetishweeklytsypkinpainslutxdumbbigtittedslutworkaholicatrestdoyoulikethat-sluteverydaycollarssubmissive-monarchdailypornocreamfacesheeladvisedtrooper505bondageloverffncollectordr-tarlanalmom69hotlatexoutfitsjustnippleclampsfetish4her-masterakinkygentsuckitbimbogettingbusyintheofficelabialoungemochavanillalattebdsmropebondagelacemepicmanbdsmecstasyinrestraintslightworshipmarriedbutherestaffnightsmutonly-secretariesjoinmilehighclubcuriously-shy-slutschoolgirlsonwoodstairsfilthyzensoredfuckyeahanalfaceindetentionaltpornlipstixxxhappybdsmmywifetheslutalexintheaislechilxlibraryvixentaroid5slaveshousesainttriniansfuckyeahfrenchmaidsbondagedreaminfernanaldeepanaldildoawesomegapesandanalinsertionsacademyfordifficultgirlssomefetishespeselectrodollkinkybasetlienshot-uniform-milfslavetrainingserasedmaphourglass-silhouettenankingdecadefacesofanalsmaster667glovedandboundkinkydaytheporcelainlakerealashleyreneeaslikeassfuckyeahbuttplugsdonebutwitherrorsonpagesadisticgameschloecumslutnomdegsubmissivegingergaggedandforeverboundkousokuslavepetsantiquerestbiffjr99felixdartmouthnettersklavegretchenmusingsanothersecretfetishmaxlatenfemaledenialdiederiqsmaidsbimbosminderpuppygirlsnplaythingsbendingsubmissionsluttybunnywanderer-of-dark-dreamssoupergirlgaggedkissingstrictworldfaye6vysovenfap-labbendmeovershinyretrostingysexnotsexsubmissivenikkinaughtycinderellaaryehpridebighappyfacewearegoingtohellslavegardentocamusicaair-tripthetamingofaslutjstbdsmfuckmakerdtnhbdthe-mouth-of-the-goddesskneelbegcrawlbackseamextremekneel4himdaddysbrokengirlheathen-pleasuresfuckyeahballgagsgingerbellesbedroomsubjuanitaninaninetafuck-n-fight-clubnylonfoxielostlittlesubropeculturestuffitinmemodfetishyesdaddyrapedollieangelinadanaewhisperingonly-ball-gagstransformhersimplewishesdementedkittenmr-s000-xxxthingsiddotoyouslaveelliesundash22fluffyropesundercoverkinksterpigtailprincesstroisiemebringonxtoyspolaritiessmutilovefetishphotosshinoatdarkalittlespicyiambic9sunnycuntdoorstomanualnametobedeterminedariannaacquiescesvoluntarytourettesnymphomaniac-fantasiaeditorforaweekcollaredprincesscabernetsauvignonzebraspornartofpornbarcodedbitchthesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreyharlettedaisysubdolldressedvisitingsodomfeckfeckfeckfrenchmaidsweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr