1. Notes: 94 / 1 year ago  from harlette (originally from jukuvich)
    Oohh.. that’s wicked, love it! harlette: “Stand up straight and read to the class.” I wonder, when she makes a mistake, do the student get to spank her? (via jukuvich)

    Oohh.. that’s wicked, love it!

    harlette:

    “Stand up straight and read to the class.”

    I wonder, when she makes a mistake, do the student get to spank her?

    (via jukuvich)

     

  2. Notes

    1. cuckoldn reblogged this from yeoldebdsm
    2. denyingmyself reblogged this from yeoldebdsm
    3. sexswitch reblogged this from briannamayhem
    4. briannamayhem reblogged this from serendipityslave and added:
      It does doesn’t it, girl. Maybe my girl could do...for us *wink; uncoils the rope …
    5. meladramarain reblogged this from serendipityslave and added:
      do a mundane task that does require concentration while all this going on.
    6. serendipityslave reblogged this from yeoldebdsm and added:
      that looks like a fun poetry reading to attend
    7. yeoldebdsm reblogged this from narr
    8. ragoh reblogged this from seberinichiro
    9. narcotism reblogged this from sander786
    10. bester reblogged this from despairs
    11. despairs reblogged this from ropebondage
    12. hardpunk reblogged this from ropebondage
    13. pictureofdepravity reblogged this from ropebondage
    14. jukuvich posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornolabialoungefuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr