1. Notes: 182 / 8 months ago  from chilx (originally from farmd0g)
    Every girl looks good like that donebutwitherrorsonpage: I like the ZEN book on the table; remember, you can’t spell Buddhism without B, D, S, and M…

    Every girl looks good like that

    donebutwitherrorsonpage:

    I like the ZEN book on the table; remember, you can’t spell Buddhism without B, D, S, and M…

     

  2. Notes

    1. shanemorrison reblogged this from respexit
    2. midsummerman reblogged this from misscontrol
    3. sexyfishatnight reblogged this from tieduptoys
    4. sexualobjectification reblogged this from tieduptoys
    5. yppigt reblogged this from bdsm
    6. crusin4brusin reblogged this from bdsm
    7. llsed31 reblogged this from candysmut
    8. dirtylilfreaky reblogged this from candysmut
    9. candysmut reblogged this from reallydirtythings
    10. homer06 reblogged this from themostdangerousplaything
    11. wwwsputnik reblogged this from misscontrol
    12. kurvdkoc reblogged this from eroticpursuits
    13. eroticpursuits reblogged this from themovingfingerwrites
    14. juancafe13 reblogged this from themovingfingerwrites and added:
      is very fucking HOT!
    15. themovingfingerwrites reblogged this from pirate-for-hire and added:
      i just bought myself a new entertainment centre, at least this one isn’t ‘flat pack’
    16. pirate-for-hire reblogged this from reallydirtythings
    17. giermo reblogged this from akinkygent
    18. akinkygent reblogged this from bdsm
    19. prondash reblogged this from chilx
    20. mrthumper reblogged this from tieduptoys
    21. tieduptoys reblogged this from bigjaysfavs
    22. chilx reblogged this from bigjaysfavs
    23. degaslamp reblogged this from bigjaysfavs
    24. bigjaysfavs reblogged this from chilx and added:
      Every girl looks good like that
    25. respexit reblogged this from donebutwitherrorsonpage
    26. zartbitter6 reblogged this from deltagagged
    27. deltagagged reblogged this from farmd0g
    28. dominate-submit reblogged this from farmd0g
    29. fetishsm reblogged this from donebutwitherrorsonpage
    30. planetearthfactory reblogged this from donebutwitherrorsonpage
    31. bobschwartz reblogged this from tiedtightly
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungekousokudailypornofuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr