1. Notes: 39 / 6 months ago  from thingsiddotoyou (originally from humanpony)
    Where can you buy these? thingsiddotoyou: humanpony!

    Where can you buy these?

    thingsiddotoyou:

    humanpony!

     

  2. Notes

    1. andrequartier reblogged this from humanpony
    2. glossy-couple reblogged this from humanpony
    3. oddandkinky reblogged this from humanpony
    4. bootfetish reblogged this from bigjaysfavs
    5. bigjaysfavs reblogged this from thingsiddotoyou and added:
      Where can you buy these?
    6. lordspooner reblogged this from thingsiddotoyou
    7. thingsiddotoyou reblogged this from latexcatsuit
    8. dream-fact0ry reblogged this from humanpony
    9. femdomhotwifecuckoldinterracial reblogged this from humanpony
    10. formsforms reblogged this from humanpony
    11. toy4lust reblogged this from latexcatsuit
    12. deepperversion reblogged this from latexcatsuit and added:
      Lovely workout boots
    13. reistorm reblogged this from latexcatsuit
    14. bakichen reblogged this from humanpony
    15. hsmt reblogged this from latexcatsuit
    16. distantflamebeforethesun reblogged this from latexcatsuit
    17. latexcatsuit reblogged this from shinyretrostingy
    18. mrw747 reblogged this from shinyretrostingy
    19. grimly reblogged this from shinyretrostingy
    20. shinyretrostingy reblogged this from humanpony
    21. humanpony posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornokousokulabialoungefuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr