1. Notes: 52 / 6 months ago  from trussed
    Cute!

    Cute!

    (Source: trussed)

     

  2. Notes

    1. killercowboy reblogged this from bound-love
    2. fuck-us-senseless reblogged this from sheaseyecandyboutique
    3. minniespmpnu1 reblogged this from v-for-vishous
    4. misterq222 reblogged this from bound-love
    5. sheaseyecandyboutique reblogged this from v-for-vishous
    6. shotin reblogged this from bound-love
    7. v-for-vishous reblogged this from bound-love
    8. obeyingdom reblogged this from bound-love
    9. bound-love reblogged this from bagoffuntricks
    10. bagoffuntricks reblogged this from sarugutsuwa
    11. thebeavs reblogged this from sarugutsuwa
    12. sarugutsuwa reblogged this from trussed
    13. submissiveladies reblogged this from bigjaysfavs
    14. thepretender8 reblogged this from bigjaysfavs
    15. bigjaysfavs reblogged this from trussed
    16. calinecoraline reblogged this from sofarocker69
    17. bbwlovefromgermany reblogged this from sofarocker69
    18. sofarocker69 reblogged this from traitane
    19. traitane reblogged this from thefarawaybeach
    20. thefarawaybeach reblogged this from themephistos
    21. themephistos reblogged this from bitoruff
    22. bitoruff reblogged this from closetfullofsecrets
    23. fuckyeahcleavegags reblogged this from trussed
    24. diederiq reblogged this from closetfullofsecrets
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornofuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr