1. Notes: 264 / 5 months ago  from storymansland (originally from loveabitch)
    My wife has socks just like this
storymansland:

Perfect assistant

    My wife has socks just like this

    storymansland:

    Perfect assistant

     
  2. Notes

    1. zztoplee reblogged this from alittlespicy
    2. farrah-matthews reblogged this from sexygeekbitch
    3. peachesplayground reblogged this from bookporn
    4. poeticchaos reblogged this from girlsgeeksandglasses
    5. deltoagrimensura reblogged this from nakedgirlswithbooks
    6. nakedgirlswithbooks reblogged this from booksaresexy
    7. awaymichaelgoes reblogged this from alittlespicy
    8. pl4gu3d0g reblogged this from girlsgeeksandglasses
    9. denversatyr reblogged this from alittlespicy
    10. blackwolfalpha reblogged this from alittlespicy
    11. thelionspride reblogged this from anejo1862
    12. destructivenature reblogged this from alittlespicy
    13. beautiful-obsession reblogged this from anejo1862
    14. anejo1862 reblogged this from alittlespicy
    15. alittlespicy reblogged this from bigjaysfavs and added:
      I’m of the firm believe that every good girl and classy lady should always have at least one pair of fantastic argyle...
    16. booksandbabes reblogged this from bigjaysfavs
    17. wassit reblogged this from bigjaysfavs and added:
      And then Playboy does this….nice redemption from the Lohan debacle
    18. bigjaysfavs reblogged this from storymansland and added:
      My wife has socks just like this
    19. perfectboobss reblogged this from sexncomics
    20. ihateeverythingbutyou reblogged this from hipslipstitsandladybits
    21. trippystep reblogged this from thehottesthere
    22. saganth reblogged this from sexncomics
    23. sexncomics reblogged this from hipslipstitsandladybits
    24. sexaminarea reblogged this from uniuma
    25. uniuma reblogged this from storymansland
    26. heathen84 reblogged this from thehottesthere
    27. kkst reblogged this from thehottesthere
    28. kitkhsh69 reblogged this from thehottesthere
    29. flawlessbody reblogged this from thehottesthere
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungefuckyeahstockingskousokudailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr