1. Notes: 156 / 1 year ago  from brigiddomme (originally from chicadecuba)
    Nice touch, balancing like that, love the pink rope! brigiddomme: fuckyeahspreaderbars: (via chicadecuba)

    Nice touch, balancing like that, love the pink rope!

    brigiddomme:

    fuckyeahspreaderbars:

    (via chicadecuba)

     

  2. Notes

    1. fesselspieler reblogged this from bondagepets
    2. abovecenter reblogged this from kneelbegcrawl and added:
      Wear this outfit and I will definitely go to a roller rink with you
    3. daddysfucktoys reblogged this from bondagepets
    4. sheknowswhatsbestforme reblogged this from bondagepets
    5. sidontaa reblogged this from bigjaysfavs
    6. tdcstr reblogged this from kneelbegcrawl
    7. closetcontrol reblogged this from bondagepets
    8. mooo reblogged this from chicadecuba
    9. mvpretty reblogged this from bigjaysfavs
    10. asexyparty reblogged this from black-kitty
    11. lissamatthews reblogged this from bigjaysfavs
    12. bigjaysfavs reblogged this from brigiddomme and added:
      Nice touch, balancing like that, love the pink rope!
    13. crispycritter reblogged this from black-kitty
    14. black-kitty reblogged this from mesexploits
    15. pockettheaffront reblogged this from pervylilgirl
    16. sin260 reblogged this from shinoatdark
    17. shinoatdark reblogged this from bondagepets
    18. propriety reblogged this from nocorrelation
    19. pervylilgirl reblogged this from schbank and added:
      This could represent one-third of my fantasy life as a Roller Derby princess/Burlesque Performer/Belly Dancer. I need...
    20. whipherslacker reblogged this from smutilove
    21. smutilove reblogged this from crossdressingchloe
    22. mmmkink reblogged this from shinyretrostingy
    23. dripping reblogged this from fuckyeahspreaderbars
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterfuckyeahstockingslabialoungedailypornokousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr