1. Notes: 143 / 4 months ago  from mywifetheslut (originally from dirtyfilthyfucking)
    Not surprising she’s not. After all she hardly drinks. ;-) mywifetheslut: Wish my wife was more into stuffing like this..

    Not surprising she’s not. After all she hardly drinks. ;-)

    mywifetheslut:

    Wish my wife was more into stuffing like this..

    (Source: dirtyfilthyfucking)

     

  2. Notes

    1. culoabierto reblogged this from mywifetheslut
    2. extremeinsertions reblogged this from newfoundfetish
    3. thighman812 reblogged this from mywifetheslut
    4. nin0rata reblogged this from gagbrat and added:
      Para brindar en navidad
    5. gagbrat reblogged this from mywifetheslut
    6. worthless-cunt reblogged this from mywifetheslut and added:
      This is extreamly hot..
    7. x-posting reblogged this from gettingstuffed
    8. nice-bad-world reblogged this from cockteaser
    9. cockteaser reblogged this from ddesire74
    10. superpic reblogged this from dasein0830
    11. thingsthatamaze reblogged this from dasein0830
    12. dasein0830 reblogged this from bigjaysfavs
    13. ddesire74 reblogged this from uarenumber6
    14. uarenumber6 reblogged this from mywifetheslut
    15. dicksnboobsnbuttsncunts reblogged this from mywifetheslut
    16. sexpositivesissy reblogged this from mywifetheslut and added:
      That’s in her ASS. Imagine the work, dedication, and patience this took.
    17. mrhollaout reblogged this from bigjaysfavs and added:
      Love bitches that do this
    18. bigjaysfavs reblogged this from mywifetheslut and added:
      Not surprising she’s not. After all she hardly drinks. ;-)
    19. foxbox reblogged this from mywifetheslut
    20. jordan21185 reblogged this from mywifetheslut
    21. greeklion reblogged this from mywifetheslut and added:
      Popped Cherry Champaign - I wonder if she felt the kickback when they popped the cork.
    22. mywifetheslut reblogged this from dirtyfilthyfucking and added:
      Wish my wife was more into stuffing like this..
    23. 4datzwawewanna reblogged this from dirtyfilthyfucking
    24. suckmeassbitch reblogged this from gettingstuffed
    25. gloaderball reblogged this from hermionepinklady
    26. hermionepinklady reblogged this from photosick
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokulabialoungedailypornofuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr