1. Notes: 571 / 4 months ago  from bythelady (originally from redmagick666)
    Yes, just keep pulling!
bythelady:

Yes!

    Yes, just keep pulling!

    bythelady:

    Yes!

    (Source: redmagick666)

     
  2. Notes

    1. libertineitch reblogged this from girlbutts
    2. geterdone2013 reblogged this from girlbutts
    3. lushun reblogged this from girlbutts
    4. girlbutts reblogged this from stufftheturkey and added:
      While they are not exactly huge anal beads, the are wonderful to see being pulled out of her anus, especially with the...
    5. scrball reblogged this from stufftheturkey
    6. stufftheturkey reblogged this from newfoundfetish
    7. morchaint reblogged this from gokcobbler
    8. spankatronic reblogged this from newfoundfetish
    9. secret-submissive reblogged this from goodstuffthatwelove
    10. insatiableapp reblogged this from goodstuffthatwelove
    11. goodstuffthatwelove reblogged this from allhardcorexxx
    12. urielswing reblogged this from deviant-tradition
    13. deviant-tradition reblogged this from themovingfingerwrites and added:
      “So that’s where you have been hiding them! …I should have known!”
    14. ropeandrubber reblogged this from mistressivey
    15. dominationiskey reblogged this from mistressivey
    16. mistressivey reblogged this from klaus-dett
    17. klaus-dett reblogged this from best-porn-on-tumblr
    18. randomporny39 reblogged this from aleycat
    19. aleycat reblogged this from randomlyerotic and added:
      Annette Schwarz gives a tug
    20. hoolordilove reblogged this from randomlyerotic
    21. sosexlive reblogged this from randomlyerotic
    22. isht reblogged this from randomlyerotic
    23. makeutakeit reblogged this from pablocouk
    24. justsomeporn reblogged this from randomlyerotic and added:
      just some exciting blog liked this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterfuckyeahstockingsdailypornolabialoungekousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr