1. Notes: 43 / 1 year ago  from harlette (originally from picmanbdsm)
    Oh so true. Nice position too! harlette: When she looks that scared, you are doing it right.

    Oh so true. Nice position too!

    harlette:

    When she looks that scared, you are doing it right.

     

  2. Notes

    1. fetishfaves reblogged this from harlette
    2. boundall reblogged this from itbelongstodaddy
    3. wifex reblogged this from picmanbdsm
    4. johnnynoir reblogged this from shinyretrostingy
    5. shinyretrostingy reblogged this from apervertedgentleman
    6. approach-with-caution-i-bite reblogged this from akinkygent
    7. apervertedgentleman reblogged this from akinkygent
    8. akinkygent reblogged this from picmanbdsm
    9. itbelongstodaddy reblogged this from harlette
    10. astralseaofevil reblogged this from bigjaysfavs
    11. trainingmywife reblogged this from picmanbdsm and added:
      I really like this tie. I am going to try in on my wife next time.
    12. mshurtmeplz reblogged this from smutcentral
    13. smutcentral reblogged this from bigjaysfavs and added:
      bigjaysfavs : harlette
    14. bigjaysfavs reblogged this from harlette and added:
      Oh so true. Nice position too!
    15. harlette reblogged this from picmanbdsm and added:
      are doing it right.
    16. hisdirtyprincess reblogged this from mywifetheslut
    17. mywifetheslut reblogged this from ropebondage and added:
      That, and the way she is tied up: WIN
    18. drakulo reblogged this from master-of-maenad
    19. master-of-maenad reblogged this from shinyretrostingy
    20. shide reblogged this from picmanbdsm
    21. ropebondage reblogged this from picmanbdsm
    22. picmanbdsm posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornofuckyeahstockingskousokulabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr