1. Notes: 79 / 1 month ago  from akinkygent (originally from bdsm69)
    akinkygent: Good use for slaves!

    akinkygent:

    Good use for slaves!

    (Source: bdsm69)

     

  2. Notes

    1. grlspnkr reblogged this from 666marlin
    2. shrink558 reblogged this from prettynaughtythings
    3. sexytogirlsin reblogged this from ddesire74
    4. tinyarmstiedup reblogged this from prettynaughtythings and added:
      Oh but Master! Is this what you had in mind by “Maid”?
    5. eroticmeanderings reblogged this from prettynaughtythings
    6. llllgallery reblogged this from kikicream
    7. sexyfishatnight reblogged this from sin260
    8. ddesire74 reblogged this from kikicream
    9. kikicream reblogged this from bdsm69
    10. bigjaysfavs reblogged this from akinkygent
    11. sin260 reblogged this from bdsm69
    12. countsix reblogged this from 666marlin
    13. suckmydicklikethis reblogged this from 666marlin
    14. slut-cherrys reblogged this from 666marlin
    15. stephanie-le-slutau reblogged this from 666marlin and added:
      A true coffee wench :)
    16. 666marlin reblogged this from whiterabbit0117
    17. akinkygent reblogged this from scentofslave and added:
      Good use for slaves!
    18. txstranger reblogged this from bndgelvr
    19. bndgelvr reblogged this from scarcro
    20. surrenderisland reblogged this from whiterabbit0117 and added:
      hattie’s Master wants another cup of coffee before He leaves for work today. hattie has already made her Master and...
    21. thedeviantthingsilike reblogged this from bdsm69 and added:
      I find this strangely erotic.
    22. masuta4u reblogged this from scentofslave
    23. thatsallfetish reblogged this from bdsm69
    24. slaves25 reblogged this from scentofslave
    25. mynervousmind reblogged this from whiterabbit0117
    26. ouertu reblogged this from bdsm69 and added:
      Remind me of my place every minute -s
    27. tsara9livecom reblogged this from scentofslave
    28. scentofslave reblogged this from bdsm69
    29. jackslumper reblogged this from whiterabbit0117
    30. scarcro reblogged this from whiterabbit0117
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

puppygirlsnplaythingsthedirtysidefuckyeahbuttplugsdownherthroatmodfetishshinyretrostingyfetish4dailypornotrussedeverydaycollarsfuckyeahstockingslingerie-loveantiquerestakinkygentvoluntarytouretteserasedmapcanipleasecum-sirworkaholicatrestlabialoungealtpornaryehpridevisualfetishsexnotsexbendingsubmissionsubselfart-or-pornmind-effingsmutilovepainslutxchilxsoupergirlspankablemaidsdementedkittenundercoverkinksterbackseamextremekneelbegcrawlrealashleyrenee333imagesdontyoufuckingmovesubmissivenikkiawesomegapesandanalinsertionsbondagedreamkinklibraryvixenkousokuxxxtoonsxxxvysovenslaveshousefluffyropesfuckyeahfrenchmaidsdanaewhisperinghisownedwifekneel4himlostlittlesubbdsmfuck-n-fight-clubfuckyeahballgagskinkydaydtnhbdfuckmakermywifetheslutnettersklavelordschuftfitandfetishsomefetishestsypkinkinkamateursgingerbellesbedroombringonxtoysbdsm69anothersecretfetishtaroid5bendmeoverdiaryofasubfreakcuriously-shy-slutbondagebunnyecstasyinrestraintsnomdegstrictworldgretchenmusingsnylonfoxiestaffdonebutwitherrorsonpagedaddysbrokengirlorgasmgivrsluttybunnybytheladypicmanbdsmropebondageninaninetaslavepetsbrattytrampstolzebighappyfaceohyeahharderpolaritiesthetamingoftheslutplayswithdollsyesdaddycumdollshinoatdarksmaster667wearegoingtohellnaughtycinderellatroisiemelikeabikeseatsimplewishestransformherariannaacquiescesthingsiddotoyoudddecembercollaredprincessbiffjr99slavegardencabernetsauvignonnymphomaniac-fantasiamr-sinfernanalslaveellienickthedickreloadedzebraspornfreckyeahfucklesartofpornbarcodedbitchelizajaneblackfuckyouredheadskindlybeatingheriambic9dollkinkythesophisticatedslutcontrolwhips-and-chains-make-me-excitedfaye6sashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsjstbdsmmarkdezantscandalouswenchfuckimsorryeditorforaweekplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr