1. Notes: 72 / 1 month ago  from visualfetish (originally from lacedwithjenn)

    (Source: lacedwithjenn)

     
  2. Notes

    1. latexlingere reblogged this from donotstareintolaser
    2. intox reblogged this from somefetishes
    3. anchwhore reblogged this from zbirdy
    4. zbirdy reblogged this from lacedwithjenn
    5. theplaything reblogged this from hothornyann
    6. dollyroseblog reblogged this from im-hard-shes-wet and added:
      So sexy, I wish I had a pair like this.
    7. getbearded reblogged this from mustgetmilk
    8. brittnilynn reblogged this from mustgetmilk
    9. mustgetmilk reblogged this from lacedwithjenn
    10. follomeontheeskay reblogged this from visualfetish
    11. cherrywaaves reblogged this from im-hard-shes-wet
    12. im-hard-shes-wet reblogged this from lacedwithjenn
    13. bigjaysfavs reblogged this from visualfetish
    14. benlylh reblogged this from visualfetish
    15. donotstareintolaser reblogged this from visualfetish
    16. lulida reblogged this from lacedwithjenn
    17. baronsterling reblogged this from somefetishes and added:
      #legs #sexylegs #leggings
    18. elwoodsportfolio reblogged this from somefetishes
    19. desirsetsupplices reblogged this from somefetishes
    20. average-guy99 reblogged this from somefetishes
    21. contradictarycomplimentary reblogged this from somefetishes
    22. somefetishes reblogged this from visualfetish
    23. yourlittlesissy reblogged this from visualfetish
    24. seuse reblogged this from latexpics
    25. anejo1862 reblogged this from lipstickandlatex
    26. latexpics reblogged this from visualfetish
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

fetish4sexnotsexdailypornolingerie-lovetrussedaltpornworkaholicatresteverydaycollarsmind-effingfuckyeahstockingsart-or-pornsubmissivenikkichilxmodfetishawesomegapesandanalinsertionsakinkygentdownherthroatbondagedreamdontyoufuckingmovekinklibraryvixenantiquerestdementedkittendiaryofasubfreakslaveshousefuckyeahfrenchmaidsdanaewhisperinglabialoungestaffvisualfetishbendingsubmissionsmutilovefuck-n-fight-clubbackseamextremepicmanbdsmbdsmfuckyeahballgagsdtnhbdkneel4himundercoverkinkster333imagescanipleasecum-sirsomefetishesmywifetheslutpainslutxslaveellievoluntarytouretteselizajaneblackfitandfetishshinyretrostingythedirtysidepuppygirlsnplaythingsfuckyeahbuttplugserasedmaparyehpridesubselfsoupergirlspankablemaidskneelbegcrawlrealashleyreneekousokuxxxtoonsxxxvysovenfluffyropeshisownedwifelostlittlesubkinkydayfuckmakernettersklavelordschufttsypkinkinkamateursgingerbellesbedroombringonxtoysbdsm69anothersecretfetishtaroid5bendmeovercuriously-shy-slutbondagebunnyecstasyinrestraintsnomdegstrictworldgretchenmusingsnylonfoxiedonebutwitherrorsonpagedaddysbrokengirlorgasmgivrsluttybunnybytheladyropebondageninaninetaslavepetsbrattytrampstolzebighappyfaceohyeahharderpolaritiesthetamingoftheslutplayswithdollsyesdaddycumdollshinoatdarksmaster667wearegoingtohellnaughtycinderellatroisiemelikeabikeseatsimplewishestransformherariannaacquiescesthingsiddotoyoudddecembercollaredprincessbiffjr99slavegardencabernetsauvignonnymphomaniac-fantasiamr-sinfernanalnickthedickreloadedzebraspornfreckyeahfucklesartofpornbarcodedbitchfuckyouredheadskindlybeatingheriambic9dollkinkythesophisticatedslutcontrolwhips-and-chains-make-me-excitedfaye6sashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsjstbdsmmarkdezantscandalouswenchfuckimsorryeditorforaweekplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr