1. Notes: 12 / 1 month ago  from mind-effing (originally from wiscoman)
     

  2. Notes

    1. bigjaysfavs reblogged this from mind-effing
    2. luvlookingatyou reblogged this from fcks
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

fetish4dementedkittenundercoverkinksterbackseamextremeantiquerestlabialoungedailypornokneelbegcrawlworkaholicatrestlingerie-loverealashleyreneetrussedakinkygentart-or-porneverydaycollarserasedmapsexnotsex333imageschilxpuppygirlsnplaythingsvisualfetishaltpornfuckyeahstockingsdontyoufuckingmovesubmissivenikkiawesomegapesandanalinsertionsbondagedreamkinklibraryvixensmutilovekousokuxxxtoonsxxxvysovenslaveshousefluffyropesfuckyeahfrenchmaidsdanaewhisperingmind-effingaryehpridehisownedwifekneel4himlostlittlesubbdsmfuck-n-fight-clubfuckyeahballgagskinkydayvoluntarytourettesdtnhbdfuckmakermywifetheslutnettersklavedownherthroatlordschuftfitandfetishsomefetishesshinyretrostingysubselfpainslutxmodfetishthedirtysidetsypkinfuckyeahbuttplugskinkamateursgingerbellesbedroombringonxtoysbdsm69soupergirlanothersecretfetishtaroid5bendmeoverdiaryofasubfreakcuriously-shy-slutbondagebunnyecstasyinrestraintscanipleasecum-sirnomdegstrictworldgretchenmusingsnylonfoxiebendingsubmissionstaffdonebutwitherrorsonpagedaddysbrokengirlorgasmgivrsluttybunnybytheladypicmanbdsmropebondagespankablemaidsninaninetaslavepetsbrattytrampstolzebighappyfaceohyeahharderpolaritiesthetamingoftheslutplayswithdollsyesdaddycumdollshinoatdarksmaster667wearegoingtohellnaughtycinderellatroisiemelikeabikeseatsimplewishestransformherariannaacquiescesthingsiddotoyoudddecembercollaredprincessbiffjr99slavegardencabernetsauvignonnymphomaniac-fantasiamr-sinfernanalslaveellienickthedickreloadedzebraspornfreckyeahfucklesartofpornbarcodedbitchelizajaneblackfuckyouredheadskindlybeatingheriambic9dollkinkythesophisticatedslutcontrolwhips-and-chains-make-me-excitedfaye6sashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsjstbdsmmarkdezantscandalouswenchfuckimsorryeditorforaweekplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr