1. Notes: 802 / 4 months ago  from fuckyeahbuttplugs (originally from fredpoa)

    (Source: fredpoa)

     

  2. Notes

    1. mouth-full-of-asterisks reblogged this from assandholes
    2. steelrising reblogged this from creamyglaze
    3. sexandtitties reblogged this from iwantyourlust
    4. nice-bad-world reblogged this from catchingnosleep
    5. expressiveone reblogged this from creamyglaze
    6. lrdwhitetiger reblogged this from creamyglaze
    7. thenaughtygent reblogged this from catchingnosleep
    8. womenaregorgeous reblogged this from catchingnosleep
    9. catchingnosleep reblogged this from creamyglaze
    10. creamyglaze reblogged this from girlsjustwanttohavecum and added:
      Do unto others as you would have them do unto you.
    11. dino-d reblogged this from fuckyeahbuttplugs
    12. picsthatmakeme reblogged this from americaninfidel09
    13. morpheus-69 reblogged this from fuckmecrazybaby
    14. shuffleporn reblogged this from lefrench33
    15. isht reblogged this from fuckmecrazybaby
    16. properly-promiscuous reblogged this from fuckmecrazybaby
    17. embrace-your-fucking-wild-side reblogged this from fuckmecrazybaby
    18. varietyisgood reblogged this from kavlitseki
    19. penny-crayon-bitchez reblogged this from iwantyourlust
    20. mynewpage reblogged this from fuckmecrazybaby
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornofuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr