1. Notes: 780 / 1 month ago  from fuckyeahbuttplugs (originally from fredpoa)

    (Source: fredpoa)

     

  2. Notes

    1. sweetthang808 reblogged this from fuckinglust
    2. thingsthatturnmycrank reblogged this from fuckyeahbuttplugs
    3. waytoocrunchy reblogged this from fuckyeahbuttplugs
    4. sextolife reblogged this from femaleasslover
    5. analoholic reblogged this from fuckyeahbuttplugs
    6. tintedmind reblogged this from tailsandtoys
    7. saydoe reblogged this from depraved-girls
    8. sexuallhealing reblogged this from daydreamsofdaddy
    9. daydreamsofdaddy reblogged this from depraved-girls
    10. sharingallmysecrets reblogged this from depraved-girls
    11. odeargod reblogged this from depraved-girls
    12. trooper505 reblogged this from depraved-girls
    13. eskimolee reblogged this from tailsandtoys
    14. varietyisgood reblogged this from depraved-girls
    15. depraved-girls reblogged this from tailsandtoys
    16. tailsandtoys reblogged this from thefaplodge
    17. sexloverotic reblogged this from addictedtofuckingandsex
    18. lovetolick reblogged this from addictedtofuckingandsex and added:
      awwww thats adorable, they must be best friends
    19. thefaplodge reblogged this from fuckyeahbuttplugs
    20. pilferspost reblogged this from fuckyeahbuttplugs
    21. voodoodogtown reblogged this from paintedpants
    22. diverfl reblogged this from paintedpants
    23. doesitdoit4u reblogged this from paintedpants
    24. ma13ut1c5 reblogged this from paintedpants
    25. pseudosex reblogged this from paintedpants
    26. trooper505 reblogged this from paintedpants
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

altpornfetish4dailypornoeverydaycollarsmodfetishdownherthroattrussedthedirtysidelingerie-lovevisualfetishakinkygentantiquerestpuppygirlsnplaythingsfuckyeahbuttplugslabialoungeshinyretrostingyfuckyeahstockingsvoluntarytouretteserasedmapcanipleasecum-sirworkaholicatrestaryehpridesexnotsexbendingsubmissionsubselfart-or-pornmind-effingsmutilovepainslutxchilxsoupergirlspankablemaidsdementedkittenundercoverkinksterbackseamextremekneelbegcrawlrealashleyrenee333imagesdontyoufuckingmovesubmissivenikkiawesomegapesandanalinsertionsbondagedreamkinklibraryvixenkousokuxxxtoonsxxxvysovenslaveshousefluffyropesfuckyeahfrenchmaidsdanaewhisperinghisownedwifekneel4himlostlittlesubbdsmfuck-n-fight-clubfuckyeahballgagskinkydaydtnhbdfuckmakermywifetheslutnettersklavelordschuftfitandfetishsomefetishestsypkinkinkamateursgingerbellesbedroombringonxtoysbdsm69anothersecretfetishtaroid5bendmeoverdiaryofasubfreakcuriously-shy-slutbondagebunnyecstasyinrestraintsnomdegstrictworldgretchenmusingsnylonfoxiestaffdonebutwitherrorsonpagedaddysbrokengirlorgasmgivrsluttybunnybytheladypicmanbdsmropebondageninaninetaslavepetsbrattytrampstolzebighappyfaceohyeahharderpolaritiesthetamingoftheslutplayswithdollsyesdaddycumdollshinoatdarksmaster667wearegoingtohellnaughtycinderellatroisiemelikeabikeseatsimplewishestransformherariannaacquiescesthingsiddotoyoudddecembercollaredprincessbiffjr99slavegardencabernetsauvignonnymphomaniac-fantasiamr-sinfernanalslaveellienickthedickreloadedzebraspornfreckyeahfucklesartofpornbarcodedbitchelizajaneblackfuckyouredheadskindlybeatingheriambic9dollkinkythesophisticatedslutcontrolwhips-and-chains-make-me-excitedfaye6sashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsjstbdsmmarkdezantscandalouswenchfuckimsorryeditorforaweekplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr