1. Notes: 59 / 1 year ago  from harlette (originally from faye6)
    I love predicament bondage! harlette: I wonder how lang she can bend her feet like that, before she has to give in and relax them. The effect of the hot dripping wax on her pussy will probably add to her willpower.

    I love predicament bondage!

    harlette:

    I wonder how lang she can bend her feet like that, before she has to give in and relax them. The effect of the hot dripping wax on her pussy will probably add to her willpower.

     

  2. Notes

    1. sexuallyoriented reblogged this from masterfaith
    2. masterfaith reblogged this from befke
    3. donebutwitherrorsonpage reblogged this from faye6 and added:
      Wax Wednesday…
    4. w45ted reblogged this from myuntitledfetish
    5. bondage-tr reblogged this from myuntitledfetish
    6. myuntitledfetish reblogged this from uniquetrouble
    7. lesquid reblogged this from uniquetrouble
    8. uniquetrouble reblogged this from ropebondage
    9. kazuco reblogged this from ropebondage
    10. bigjaysfavs reblogged this from harlette and added:
      love predicament bondage!
    11. moonlightbutterflies reblogged this from ropebondage
    12. fitandfetish reblogged this from faye6
    13. harlette reblogged this from faye6 and added:
      I wonder how lang she can bend her feet like that, before she has to give in and relax them. The effect of the hot...
    14. littletreat reblogged this from sweetsurrenders
    15. sweetsurrenders reblogged this from faye6
    16. faye6 posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungefuckyeahstockingsdailypornokousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr