1. Notes: 4 / 1 month ago  from bookmarklet
    That’s the look! Good expression, exactly the right colour lipstick.

    That’s the look! Good expression, exactly the right colour lipstick.

     
  2. Notes

    1. fatalfetish reblogged this from bigjaysfavs
    2. bigjaysfavs posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

modfetishdownherthroattrussedfetish4dailypornothedirtysidelingerie-lovevisualfetishakinkygentantiqueresteverydaycollarspuppygirlsnplaythingsfuckyeahbuttplugslabialoungeshinyretrostingyfuckyeahstockingsvoluntarytouretteserasedmapcanipleasecum-sirworkaholicatrestaltpornaryehpridesexnotsexbendingsubmissionsubselfart-or-pornmind-effingsmutilovepainslutxchilxsoupergirlspankablemaidsdementedkittenundercoverkinksterbackseamextremekneelbegcrawlrealashleyrenee333imagesdontyoufuckingmovesubmissivenikkiawesomegapesandanalinsertionsbondagedreamkinklibraryvixenkousokuxxxtoonsxxxvysovenslaveshousefluffyropesfuckyeahfrenchmaidsdanaewhisperinghisownedwifekneel4himlostlittlesubbdsmfuck-n-fight-clubfuckyeahballgagskinkydaydtnhbdfuckmakermywifetheslutnettersklavelordschuftfitandfetishsomefetishestsypkinkinkamateursgingerbellesbedroombringonxtoysbdsm69anothersecretfetishtaroid5bendmeoverdiaryofasubfreakcuriously-shy-slutbondagebunnyecstasyinrestraintsnomdegstrictworldgretchenmusingsnylonfoxiestaffdonebutwitherrorsonpagedaddysbrokengirlorgasmgivrsluttybunnybytheladypicmanbdsmropebondageninaninetaslavepetsbrattytrampstolzebighappyfaceohyeahharderpolaritiesthetamingoftheslutplayswithdollsyesdaddycumdollshinoatdarksmaster667wearegoingtohellnaughtycinderellatroisiemelikeabikeseatsimplewishestransformherariannaacquiescesthingsiddotoyoudddecembercollaredprincessbiffjr99slavegardencabernetsauvignonnymphomaniac-fantasiamr-sinfernanalslaveellienickthedickreloadedzebraspornfreckyeahfucklesartofpornbarcodedbitchelizajaneblackfuckyouredheadskindlybeatingheriambic9dollkinkythesophisticatedslutcontrolwhips-and-chains-make-me-excitedfaye6sashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsjstbdsmmarkdezantscandalouswenchfuckimsorryeditorforaweekplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr