1. Notes: 125 / 4 months ago  from shinyretrostingy (originally from goshuujin)
    Pretty young thing

    Pretty young thing

    (Source: goshuujin)

     
  2. Notes

    1. private1999 reblogged this from collarandcuffs
    2. frighteninglust reblogged this from yotherself
    3. kindheartedsadisticbastard reblogged this from bigjaysfavs
    4. realturnones reblogged this from bigjaysfavs
    5. jadecw reblogged this from collarandcuffs
    6. elycit reblogged this from mstr-k
    7. mstr-k reblogged this from shinyretrostingy
    8. bunnyfreckles reblogged this from collarandcuffs
    9. algolagnickitten reblogged this from bigjaysfavs
    10. build-high-for-happiness reblogged this from collarandcuffs
    11. paulsposts reblogged this from collarandcuffs
    12. ieatcum reblogged this from themephistos
    13. love-and-sex1 reblogged this from sarrada-na-minha-buceta
    14. sarrada-na-minha-buceta reblogged this from themephistos
    15. themephistos reblogged this from collarandcuffs
    16. thisguysplace reblogged this from collarandcuffs
    17. artillery-range reblogged this from bigjaysfavs
    18. collarandcuffs reblogged this from everydaycollars
    19. bigjaysfavs reblogged this from shinyretrostingy and added:
      Pretty young thing
    20. psybondage reblogged this from everydaycollars
    21. everydaycollars reblogged this from shinyretrostingy
    22. joekink reblogged this from deliciousanddecadence
    23. voluptuousnesss reblogged this from deliciousanddecadence
    24. absoluteporn reblogged this from deliciousanddecadence
    25. deliciousanddecadence reblogged this from secretdaddy
    26. livesmanylives reblogged this from deliciousclementine
    27. deliciousclementine reblogged this from yotherself
    28. dig1tallove reblogged this from goshuujin
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokudailypornolabialoungefuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr