1. Notes: 168 / 4 months ago  from sensual-yorkshire-redhead (originally from mrjackthereal)
    Smile all you like, you know wearing panties is against the dress code.
sensual-yorkshire-redhead:

In the office, ready and waiting…

    Smile all you like, you know wearing panties is against the dress code.

    sensual-yorkshire-redhead:

    In the office, ready and waiting…

     
  2. Notes

    1. lovelifesin reblogged this from lustisa4letterword
    2. seansxxypage reblogged this from tremblingfluidheat and added:
      mmmmmm wouldn’t mind pushing you over the desk at work either…. wouldn’t even bother to pull your knickers to one side...
    3. juicor reblogged this from mr-goodbar
    4. anatmanamat reblogged this from anon-of-us
    5. bigjaysfavs reblogged this from sensual-yorkshire-redhead and added:
      Smile all you like, you know wearing panties is against
    6. takingbackthewords reblogged this from anon-of-us
    7. coquilla reblogged this from anon-of-us
    8. madnesstookme reblogged this from anon-of-us
    9. jokessp reblogged this from anon-of-us
    10. anon-of-us reblogged this from myfluffysmut
    11. myfluffysmut reblogged this from alluringsexuality
    12. alluringsexuality reblogged this from sensual-yorkshire-redhead
    13. iluvsexystockings reblogged this from blacksilkstockings
    14. sweetfigs reblogged this from tremblingfluidheat
    15. blacksilkstockings reblogged this from sensual-yorkshire-redhead and added:
      Ready for dick-tation.
    16. jholder61 reblogged this from sensual-yorkshire-redhead
    17. darkhavenslight reblogged this from scottrichard
    18. arcticfury reblogged this from tremblingfluidheat
    19. sensualpicture reblogged this from mr-goodbar
    20. grannychris54 reblogged this from tremblingfluidheat
    21. rudi76 reblogged this from sensual-yorkshire-redhead
    22. playcate reblogged this from tremblingfluidheat and added:
      hmmm i was looking for a paperclip..
    23. serg619 reblogged this from sensual-yorkshire-redhead and added:
      thats a good Secretary
    24. sensual-yorkshire-redhead reblogged this from tremblingfluidheat and added:
      In the office, ready and waiting…
    25. tremblingfluidheat reblogged this from knottydevices
    26. mistressanastasia reblogged this from knottydevices
    27. knottydevices reblogged this from redxerotica
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornolabialoungekousokufuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr