1. Notes: 641 / 4 months ago  from sensual-yorkshire-redhead (originally from hellohighheels)
    sensual-yorkshire-redhead:

A good PA is always prepared…

    sensual-yorkshire-redhead:

    A good PA is always prepared…

    (Source: hellohighheels)

     
  2. Notes

    1. mbnnw reblogged this from hisstuff
    2. hisstuff reblogged this from oldersexyhot
    3. nakedgirls-have-greathindsight reblogged this from gentlemensrelish
    4. affiges reblogged this from idnava
    5. sparklestereo reblogged this from lovelyderriere
    6. newthom reblogged this from babinus
    7. hotcplmeandshe reblogged this from developadementedmind
    8. drunksloversinnerssaints reblogged this from pleasefuckmewhilei
    9. pleasefuckmewhilei reblogged this from sublust
    10. sublust reblogged this from little-sweet--lolita
    11. solopuedoserasi reblogged this from sublust
    12. lesroses reblogged this from eroticimages
    13. s-h-i-n-i-g-a-m-i reblogged this from idnava
    14. idnava reblogged this from concreteangelphotography
    15. cornershow reblogged this from soulflux
    16. meireles7 reblogged this from diogomontana
    17. pantydropp3rs reblogged this from hellohighheels
    18. doublestuf reblogged this from enjoyingtheviews
    19. pgpapas reblogged this from soulflux
    20. ilfk reblogged this from soulflux and added:
      Just a minute…I need to change my panties first
    21. bigbudduh reblogged this from soulflux
    22. soulflux reblogged this from always-a-slave
    23. enrico1956 reblogged this from ilisten2u2
    24. ahardcd69 reblogged this from little-sweet--lolita
    25. thegustavosexperience reblogged this from fyeahnicepussy
    26. hothowards reblogged this from alwaysaroused
    27. sexy-naked reblogged this from africansouljah
    28. realthuglife reblogged this from africansouljah
    29. ilisten2u2 reblogged this from tonyivan
    30. lordravenslair reblogged this from lilvoyeurgirl
    31. swaaaaagdaddy reblogged this from diogomontana
    32. diogomontana reblogged this from africansouljah
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornofuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr