1. Notes: 154 / 4 months ago  from hard24-7 (originally from stoopsmcgoops)
    Cute those perky nipples!
hard24-7:

ilisten2u2:



http://www.hard24-7.tumblr.com/
     
  2. Notes

    1. bitchimamartian reblogged this from fabiusmaserati
    2. leonbounds reblogged this from muito-v-ulgar
    3. rawratme reblogged this from celestialenvoy
    4. celestialenvoy reblogged this from firabandit
    5. firabandit reblogged this from tastefully-female
    6. onlybrunettes reblogged this from tastefully-female
    7. sharkfacedidi reblogged this from bigjaysfavs
    8. bigjaysfavs reblogged this from hard24-7 and added:
      Cute those perky nipples!
    9. myproclivity reblogged this from sheseexy
    10. nastyfun101 reblogged this from born-2b-whores and added:
      subtle, sexy, real, beautiful
    11. voodoochildx reblogged this from born-2b-whores
    12. born-2b-whores reblogged this from stoopsmcgoops
    13. woodstocktool reblogged this from hard24-7
    14. straphanger28 reblogged this from herkneehighboots
    15. 0rangee3 reblogged this from sillymeat
    16. muito-v-ulgar reblogged this from hard24-7
    17. inlovewithass reblogged this from hard24-7
    18. sillymeat reblogged this from hard24-7
    19. under-a-different-sky reblogged this from myonesongbird
    20. katherinex333 reblogged this from myonesongbird
    21. myonesongbird reblogged this from tastefully-female
    22. illusionofchoice reblogged this from urtigaodream
    23. urtigaodream reblogged this from visionsofwholeoh
    24. ticklemewayman reblogged this from elosoblanco
    25. ilisten2u2 reblogged this from loewenkram
    26. tekni reblogged this from tastefully-female
    27. waleedd reblogged this from visionsofwholeoh
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungefuckyeahstockingskousokudailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr