1. Notes: 859 / 4 months ago  from hard24-7 (originally from mysexualfixation)
    All the way in!

hard24-7:

fuckmeimwet:

http://fuckmeimwet.tumblr.com/

http://www.hard24-7.tumblr.com/
     
  2. Notes

    1. gifimm reblogged this from fuckmeimwet
    2. ditasfan reblogged this from anejo1862 and added:
      Il va falloir progresser … :-)
    3. pheebi-jeebiez reblogged this from her-body-is-my-coffin
    4. her-body-is-my-coffin reblogged this from shannonjane
    5. um-nome-qualquer reblogged this from shannonjane
    6. scream-elizabeth reblogged this from desire212
    7. desire212 reblogged this from dirtiergifs
    8. bringintheworstinme reblogged this from dirtiergifs
    9. pa1ni reblogged this from 1dirtystranger
    10. pervertedvisions reblogged this from lucif-hard
    11. lucif-hard reblogged this from fuckmeimwet
    12. xshallowxseasx reblogged this from swaglessfag
    13. hotfantasies reblogged this from z-erenity
    14. freckles159 reblogged this from missbeee and added:
      Shit looks painful..
    15. weseebeautyx reblogged this from fuckmeimwet and added:
      Loving deep throat more and more. Had a good session recently…exhausting! X
    16. jacquiiraee reblogged this from fuckyeahfilthy
    17. tearherclothesoff reblogged this from goodthroatfuckings
    18. missbeee reblogged this from 90fuckeverybody
    19. sexneeds reblogged this from yourdesires
    20. duh-hiya reblogged this from makemetellyou
    21. 420ninja reblogged this from sexualfantasiess
    22. get-wet reblogged this from b--i--g
    23. starlikeringo reblogged this from cunts3xual
    24. kalia2301 reblogged this from fuckmeimwet
    25. bigjaysfavs reblogged this from hard24-7 and added:
      All the way in! hard24-7:
    26. 90fuckeverybody reblogged this from always-a-slave
    27. thereisnothingsexier reblogged this from soulflux
    28. makingoodlove reblogged this from fuckyeahfilthy
    29. fistsandhearts reblogged this from anejo1862
    30. retram reblogged this from sexual-tensi0n
    31. pilgrims-roomie reblogged this from nacktistschoen
    32. therealtao reblogged this from abyeparadox
    33. tumbleringing reblogged this from hard24-7
    34. aphrodisiacsfortheeyes reblogged this from fuckmeimwet and added:
      Look at her throat!
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornofuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr