1. Notes: 1428 / 4 months ago  from hard24-7 (originally from bootyoftheday)
    Slut training outside on the balcony hard24-7: http://www.hard24-7.tumblr.com/

    Slut training outside on the balcony

    hard24-7:

    http://www.hard24-7.tumblr.com/

    (Source: bootyoftheday)

     

  2. Notes

    1. brandi-jensen reblogged this from lamesaucenox
    2. cumonher92 reblogged this from polaroidplumber
    3. fuckinggifs reblogged this from hornyguitargirl
    4. bigjaysfavs reblogged this from hard24-7 and added:
      Slut training outside on the balcony
    5. zalad reblogged this from alexandhissubmissivepet
    6. thereisnothingsexier reblogged this from postcoitalsmoke
    7. hkririm reblogged this from sedutor-favorito
    8. poisonedteens-with-poisonedsouls reblogged this from iwantyourlust
    9. iwantyourlust reblogged this from textmesomethingdirty
    10. pussypanther reblogged this from collectingsex
    11. thepornivewatched reblogged this from fuckyeahsexanddrugs and added:
      what a perfect view, too bad the sun’s not out.
    12. nymphomaniac-girl reblogged this from player5010
    13. beautyandnobeasts reblogged this from hornyguitargirl
    14. 3ismagic reblogged this from pirateking001
    15. gomart27 reblogged this from black-james-deen
    16. thickbutt reblogged this from nastyfuckinggifs
    17. sexybulletsinmybrain reblogged this from nastyfuckinggifs
    18. catfan369 reblogged this from nastyfuckinggifs
    19. fuckeverythingonlife reblogged this from nastyfuckinggifs
    20. nastyfuckinggifs reblogged this from ineedapal
    21. jokessp reblogged this from pirateking001
    22. hooligan1987 reblogged this from pirateking001
    23. pirateking001 reblogged this from textmesomethingdirty
    24. awlsquee reblogged this from alexandhissubmissivepet and added:
      I love that anybody could be watching, but it’s private enough that you’d never know if anyone was. ~~Squee
    25. peerlless reblogged this from pornexistentialism
    26. unkurt reblogged this from emma-ink
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokulabialoungedailypornofuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr