1. Notes: 365 / 4 months ago  from spankopera (originally from sexcandie)
    spankopera:

Berlin? Undoubtedly getting her station-ticket’s worth anyway.
herpandora: Yummy…

    spankopera:

    Berlin? Undoubtedly getting her station-ticket’s worth anyway.

    herpandora: Yummy…

    (Source: sexcandie)

     
  2. Notes

    1. jae-dawg18 reblogged this from suckmesleezi
    2. ibustcherries reblogged this from theartofsin
    3. rebeccamalves reblogged this from callmesharlene
    4. re-j3ct reblogged this from callmesharlene
    5. suckmesleezi reblogged this from theartofsin
    6. theartofsin reblogged this from bizarre-bazaar
    7. highluxory reblogged this from spankopera
    8. najavuja reblogged this from player5010
    9. player5010 reblogged this from spankopera
    10. 1adeuus reblogged this from sexcandie
    11. giantcumfacerape reblogged this from sexcandie
    12. bigjaysfavs reblogged this from spankopera
    13. cellarheat reblogged this from spankopera
    14. spankopera reblogged this from herpandora and added:
      Berlin? Undoubtedly getting her station-ticket’s worth anyway.
    15. littlegirlfun reblogged this from sexcandie
    16. porncrastination reblogged this from sexcandie
    17. selfmadeblack reblogged this from inprezwetrust
    18. inprezwetrust reblogged this from sexcandie
    19. come-fuck-me reblogged this from sexcandie
    20. sexytogirlsoof reblogged this from hotasianamy
    21. artillerielourde reblogged this from sexcandie
    22. justsexystuff reblogged this from nothingunder
    23. sweatydoll reblogged this from sexcandie
    24. -b00bs reblogged this from sexcandie
    25. sweet-tasty reblogged this from a-memorable-fancy
    26. fyeahsextime reblogged this from sexcandie
    27. a-memorable-fancy reblogged this from fotoprofane
    28. sexcandie posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokulabialoungedailypornofuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr