1. Notes: 739 / 4 months ago  from ecstasyinrestraints (originally from bizarre-bazaar)
    ecstasyinrestraints:
We resolved to have rope nights in 2012.
hisownedwife:

Delicious.

    ecstasyinrestraints:

    We resolved to have rope nights in 2012.

    hisownedwife:

    Delicious.

     
  2. Notes

    1. clitmaster reblogged this from ropebondage
    2. avioletrose reblogged this from xspanked-masters-petx
    3. penitenceengine reblogged this from submissive-monarch
    4. formytheodora reblogged this from submissive-monarch
    5. daddywiththeuke reblogged this from submissive-monarch
    6. collarscuffsandchains reblogged this from submissive-monarch
    7. submissive-monarch reblogged this from bound-love
    8. my-wild-side reblogged this from mimeticmasturbation
    9. mimeticmasturbation reblogged this from boundballet
    10. xshevax reblogged this from bound-love
    11. whatimgoingtodotoyou reblogged this from paradox-mind
    12. morpheus-69 reblogged this from ropebondage
    13. hidden-inner-fantasies reblogged this from royb8771
    14. slaveboy123456 reblogged this from bound-love
    15. shotin reblogged this from bound-love
    16. lingering-dreams-of-you reblogged this from stunningbondage
    17. stunningbondage reblogged this from bondagepets
    18. underscore654987 reblogged this from bound-love
    19. kittybella reblogged this from ropebondage
    20. huntingbun reblogged this from southerncross666
    21. insatiabella reblogged this from bound-love
    22. bound-love reblogged this from bondagepets
    23. come-to-the-edge reblogged this from bondagepets and added:
      Oh, yes, please!
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterfuckyeahstockingsdailypornolabialoungekousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr