1. Notes: 177 / 4 months ago  from hisownedwife (originally from reumrs)
    hisownedwife: Sir, I so desire to be tightly laced into a corset for you.

    hisownedwife:

    Sir, I so desire to be tightly laced into a corset for you.

     

  2. Notes

    1. ihotness reblogged this from mistressanastasia
    2. gretchenmusings reblogged this from miranda-pet
    3. mistressanastasia reblogged this from miranda-pet and added:
      you mustn’t be loose pet…
    4. miranda-pet reblogged this from iseeporn
    5. iseeporn reblogged this from 0rangee3
    6. biegod reblogged this from pinkseachele
    7. thefunsideofteasing reblogged this from pinkseachele and added:
      I have been a bit tied up…bit I am here now…
    8. pinkseachele reblogged this from 0rangee3
    9. 0rangee3 reblogged this from littleq
    10. oh-rgasmic reblogged this from tentaclesandlace
    11. absinthe-cocktail reblogged this from tentaclesandlace
    12. tentaclesandlace reblogged this from yoursubmissivefemme
    13. themephistos reblogged this from dan-and-elle
    14. yoursubmissivefemme reblogged this from mistressanastasia
    15. dan-and-elle reblogged this from bigjaysfavs
    16. freshoutofthewater reblogged this from bigjaysfavs
    17. fuckingfuckingfuckyes reblogged this from pron4all
    18. yumxxiwantmore reblogged this from pron4all
    19. tumblrlude reblogged this from meinerr
    20. mykittyclaws reblogged this from pron4all
    21. meinerr reblogged this from salmonderio
    22. salmonderio reblogged this from pron4all
    23. pron4all reblogged this from bigjaysfavs
    24. bigjaysfavs reblogged this from hisownedwife
    25. silverswirl reblogged this from ghostsofavalon
    26. mamimimeow reblogged this from ghostsofavalon
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornofuckyeahstockingslabialoungekousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr