1. Notes: 148 / 3 months ago  from hisownedwife (originally from minakinks)
    Completing one of her tasks, have sex in the ladies in a public place.
hisownedwife:

Perhaps this weekend Sir?

    Completing one of her tasks, have sex in the ladies in a public place.

    hisownedwife:

    Perhaps this weekend Sir?

     
  2. Notes

    1. asailorsdream75 reblogged this from findingpics4u
    2. findingpics4u reblogged this from textmesomethingdirty
    3. kisdiscovered reblogged this from textmesomethingdirty
    4. mostlyfornoms reblogged this from carnivorouscarnation
    5. blige44 reblogged this from carnivorouscarnation
    6. pharmessiah reblogged this from carnivorouscarnation
    7. carnivorouscarnation reblogged this from textmesomethingdirty
    8. etherismyreality reblogged this from textmesomethingdirty
    9. picturesandtheirconsequences reblogged this from textmesomethingdirty
    10. collec reblogged this from textmesomethingdirty
    11. theotherss reblogged this from textmesomethingdirty
    12. lankynutcase reblogged this from textmesomethingdirty
    13. fuckedupcrap reblogged this from textmesomethingdirty
    14. happyavatar reblogged this from textmesomethingdirty
    15. hernommyangel reblogged this from textmesomethingdirty
    16. more-of-nothing reblogged this from textmesomethingdirty
    17. sissyslutheather reblogged this from textmesomethingdirty
    18. mrmofokingoftheanons reblogged this from miranda-pet
    19. art-on-the-walls reblogged this from textmesomethingdirty
    20. fuckyouveryverymuch- reblogged this from die-to-hell
    21. die-to-hell reblogged this from textmesomethingdirty
    22. djgomer reblogged this from jaredsweatshirt
    23. dontfuckinglookk reblogged this from textmesomethingdirty
    24. jaredsweatshirt reblogged this from textmesomethingdirty
    25. p0rnostar reblogged this from textmesomethingdirty
    26. assaultyoursenses reblogged this from textmesomethingdirty
    27. laddyjaja reblogged this from textmesomethingdirty
    28. livetogetradical reblogged this from textmesomethingdirty
    29. porn-sex-all-night reblogged this from textmesomethingdirty
    30. rockettvan reblogged this from textmesomethingdirty
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornofuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr