1. Notes: 352 / 3 months ago  from hisownedwife (originally from fuckyeahasa)
    Or.. “the after school tutoring really had a profound effect on her”
hisownedwife:

Sir had me choose my spanking implement.

    Or.. “the after school tutoring really had a profound effect on her”

    hisownedwife:

    Sir had me choose my spanking implement.

    (Source: fuckyeahasa)

     
  2. Notes

    1. d-s--roleplay reblogged this from fuckingalldayforlife
    2. kinkypleasures reblogged this from strictworld
    3. radadar reblogged this from bndgelvr
    4. bfaddict reblogged this from fuckyeahblindfoldedsluts
    5. nuppeman reblogged this from lustypain
    6. selinaminx reblogged this from sex-bomb and added:
      Just waiting for me to turn my attention on her … SM
    7. lil-powell reblogged this from fuckyeahasa
    8. fuckingalldayforlife reblogged this from bigjaysfavs
    9. storymansland reblogged this from yourbadgrrl
    10. boysenberrycondoms reblogged this from sex-bomb
    11. sex-bomb reblogged this from mr3x
    12. mr3x reblogged this from visualfetish
    13. johncastles reblogged this from yourbadgrrl and added:
      Some naughty school girls beg for their”punishment”.
    14. promiscuousbabygirl reblogged this from yourbadgrrl
    15. mistress-a reblogged this from yourbadgrrl
    16. daddylookingforhisgirl reblogged this from yourbadgrrl
    17. yourbadgrrl reblogged this from proudmember and added:
      “Good morning, Father Tyler!”….YBG knows how to please her art teacher…
    18. submissivewomen reblogged this from coconutsfromcocotown
    19. bndgelvr reblogged this from johnnyadidas
    20. fuckyeahblindfoldedsluts reblogged this from submissivewomen
    21. xspanked-masters-petx reblogged this from lustypain
    22. coconutsfromcocotown reblogged this from submissivewomen
    23. dicksassesandpussies reblogged this from proudmember
    24. theremedy92 reblogged this from lustypain
    25. sexkittendotin reblogged this from proudmember
    26. proudmember reblogged this from theremedy92
    27. minveodmin reblogged this from lustypain
    28. lustypain reblogged this from johnnyadidas
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokufuckyeahstockingslabialoungedailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr