1. Notes: 121 / 3 months ago  from mind-effing (originally from scentofslave)
    Bounce ‘m!

    Bounce ‘m!

    (Source: scentofslave)

     

  2. Notes

    1. augustine01 reblogged this from dommaleandsubslut
    2. slavebarbara reblogged this from txstranger
    3. awlsquee reblogged this from deliciousanddecadence
    4. kindheartedsadisticbastard reblogged this from bigjaysfavs
    5. largenipplefetish reblogged this from mistress-a
    6. apatientwolf reblogged this from bigjaysfavs
    7. moisab reblogged this from bythelady
    8. orangebubbles78 reblogged this from deliciousanddecadence and added:
      Now she was ready to ridden and have her hair pulled…
    9. bigjaysfavs reblogged this from mind-effing
    10. touchandteaseme reblogged this from deliciousanddecadence
    11. discreetlyviewed reblogged this from mistressanastasia
    12. l8terbabe reblogged this from deliciousanddecadence
    13. otixshawn reblogged this from traitane
    14. p-p-p-p reblogged this from traitane
    15. traitane reblogged this from everydaycollars
    16. softmist reblogged this from deliciousanddecadence
    17. mistress-a reblogged this from fdproper
    18. fdproper reblogged this from pthslave
    19. pthslave reblogged this from mistressanastasia
    20. sexkittendotin reblogged this from deliciousanddecadence
    21. flower-slut reblogged this from deliciousanddecadence
    22. mistressanastasia reblogged this from everydaycollars
    23. deliciousanddecadence reblogged this from everydaycollars
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterfuckyeahstockingskousokudailypornolabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr