1. Notes: 218 / 3 months ago  from erasedmap (originally from justpets)
    Yeah.. but a watch on a petgirl??
forpets:

I love her tits, and her pretty bows…

    Yeah.. but a watch on a petgirl??

    forpets:

    I love her tits, and her pretty bows…

    (Source: justpets)

     
  2. Notes

    1. kinkywearing reblogged this from justpets
    2. raiseshipseerve reblogged this from justpets
    3. tillshebegs reblogged this from erasedmap
    4. kindheartedsadisticbastard reblogged this from bigjaysfavs
    5. johnnynoir reblogged this from justpets
    6. deviantkade reblogged this from llsed31
    7. fetishload reblogged this from scentofslave
    8. llsed31 reblogged this from gameoflife1000
    9. gameoflife1000 reblogged this from mywebposts
    10. mywebposts reblogged this from fetish4
    11. thingstofapto reblogged this from fuckyeahwoohoo
    12. brainnotes reblogged this from scentofslave
    13. elegantlysexy reblogged this from curvesinthedark
    14. curvesinthedark reblogged this from fuckyeahwoohoo
    15. pantiespigtails reblogged this from fuckyeahwoohoo
    16. unrelentingdesire reblogged this from justpets
    17. wonderfulboobs reblogged this from iddoherinanewyorkminute
    18. puraleche reblogged this from iddoherinanewyorkminute
    19. bigjaysfavs reblogged this from erasedmap and added:
      Yeah.. but a watch on a petgirl??
    20. allsexallthetime reblogged this from submissivewomen
    21. submissivewomen reblogged this from fetish4
    22. pleasurefuck69 reblogged this from shotgungoddess
    23. darthgfunk reblogged this from vegasbondage
    24. shotgungoddess reblogged this from vegasbondage
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokudailypornolabialoungefuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr