1. Notes: 149 / 3 months ago  from subself (originally from theguccislut)
    subself:

i KNEW i shouldn’t have left Master and pooh bear alone together! 

    subself:

    i KNEW i shouldn’t have left Master and pooh bear alone together!
     

    (Source: theguccislut)

     
  2. Notes

    1. cafeinne reblogged this from orcdeminissaia
    2. lovtheladies reblogged this from theplaything
    3. cagedwildflower reblogged this from dadddydom and added:
      Take me to bed mister! Night y’all.
    4. miikey-mcfly reblogged this from theplaything
    5. theplaything reblogged this from theguccislut
    6. violentlypassionate reblogged this from missislaveblog
    7. bigjaysfavs reblogged this from subself
    8. twist0and0shout reblogged this from ohmyfavoritethings
    9. ohmyfavoritethings reblogged this from filmnoirlover
    10. slutscious reblogged this from slaveormaster
    11. sensualfemmefatale reblogged this from filmnoirlover
    12. knotkinky reblogged this from missislaveblog
    13. loveslave88 reblogged this from missislaveblog
    14. filmnoirlover reblogged this from missislaveblog and added:
      I would be lovely at putting you in bondage..the process will be like making love..like bonding your soul..slowly mine..
    15. slaveormaster reblogged this from sexkittendotin
    16. sexdrugs-wanderlust reblogged this from daddyfuckedme
    17. dreeeeana reblogged this from abumm
    18. abumm reblogged this from daddyfuckedme
    19. tdcstr reblogged this from missislaveblog
    20. girlswholovesex reblogged this from missislaveblog
    21. daddyandkitty reblogged this from naughtysubmissive
    22. naughtysubmissive reblogged this from sexkittendotin
    23. sexkittendotin reblogged this from missislaveblog
    24. maxloved reblogged this from missislaveblog
    25. wowieowl reblogged this from missislaveblog
    26. daddyfuckedme reblogged this from missislaveblog
    27. phoenyxsgirl reblogged this from mr-tiki
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokufuckyeahstockingsdailypornolabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr