1. Notes: 117 / 3 months ago  from mind-effing (originally from nanigasie)
    mind-effing:

“Beam me up, Scottie. I need to change my pants.”

    mind-effing:

    “Beam me up, Scottie. I need to change my pants.”

    (Source: nanigasie)

     
  2. Notes

    1. karshtakavaar reblogged this from sookystuff
    2. mildmanneredmediocrity reblogged this from zombieboyshareshisthoughts
    3. tredek reblogged this from cockorcamera and added:
      Beam me up, Bianca!
    4. cockorcamera reblogged this from nanigasie
    5. zombieboyshareshisthoughts reblogged this from sookystuff
    6. characterportraits reblogged this from sookystuff and added:
      Latex Star Trek? Really?
    7. sookystuff reblogged this from nanigasie
    8. allinspiteofyou reblogged this from fuckyeahbiancabeauchamp
    9. iheartsmut reblogged this from bigjaysfavs and added:
      Why yes, that is a latex Starfleet uniform…
    10. bigjaysfavs reblogged this from mind-effing
    11. dododds reblogged this from nanigasie
    12. youwillgetmeintrouble reblogged this from nanigasie
    13. leatherlaceandlatex reblogged this from pron4all
    14. autumnalmutterings reblogged this from mind-effing
    15. dirtylike reblogged this from nanigasie
    16. thoughtsofserobe reblogged this from nanigasie and added:
      I think this is the Ohura Out fit fromt Big Bang Theroy?
    17. braindamage69 reblogged this from pron4all
    18. thepurplemeanie reblogged this from pron4all
    19. nicenakedchicks reblogged this from slimjerome
    20. slimjerome reblogged this from pron4all
    21. auroralaurealis reblogged this from pron4all and added:
      Star Trek latex boner
    22. pron4all reblogged this from ph1lm
    23. ph1lm reblogged this from fuckyeahbiancabeauchamp
    24. gromsmind reblogged this from gloaderball
    25. welovelatex reblogged this from rubberdanny
    26. rawrevolutionepidemic reblogged this from nanigasie
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornolabialoungefuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr