1. Notes: 65 / 3 months ago  from kneelbegcrawl (originally from trussed)
    Home from work and immediately put to work again

    Home from work and immediately put to work again

    (Source: trussed)

     
  2. Notes

    1. levampire reblogged this from thehalifaxjungle and added:
      Rape me… Rape me my friend (cit.)
    2. cocoraceme38 reblogged this from axman and added:
      “What are you doing?” She shouted. “You’ll get into trouble for this. Untie me and I’ll tell no one. Just untie me now!
    3. thehalifaxjungle reblogged this from axman
    4. the-style-republic reblogged this from axman
    5. axman reblogged this from iwanttobeafirefly
    6. iwanttobeafirefly reblogged this from pinkseachele and added:
      i want to be a Firefly, Sir.
    7. cabinsandmetal reblogged this from heavy-metal-vegan
    8. heavy-metal-vegan reblogged this from redath
    9. redath reblogged this from formykittycat
    10. 47000dreams reblogged this from goodbyepopkids
    11. formykittycat reblogged this from pinkseachele
    12. pinkseachele reblogged this from chilx
    13. chilx reblogged this from tapewormer
    14. bourbonandbosoms reblogged this from smuttastic
    15. smuttastic reblogged this from yourbadgrrl
    16. atouchofflowersofevil reblogged this from truedomination
    17. hisfilthygirl reblogged this from mrz73 and added:
      I was on my way out the door for work, but He had other ideas.
    18. eternalplaymate reblogged this from truedomination
    19. mrz73 reblogged this from yourbadgrrl
    20. truedomination reblogged this from yourbadgrrl
    21. yourbadgrrl reblogged this from kneelbegcrawl and added:
      Daddy takes what’s his…even if you’re on your way to an important meeting, little one…
    22. tapewormer reblogged this from kneelbegcrawl
    23. goodbyepopkids reblogged this from bigjaysfavs
    24. bigjaysfavs reblogged this from kneelbegcrawl and added:
      Home from work and immediately put to work again
    25. bubbbba reblogged this from trussed
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokudailypornolabialoungefuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr