1. Notes: 453 / 3 months ago  from wiscoman-deactivated20120222 (originally from unnaturallybound)
    Nice and comfy on that rug
mind-effing:

Pull

    Nice and comfy on that rug

    mind-effing:

    Pull

    (Source: unnaturallybound)

     
  2. Notes

    1. badacid-tripgood reblogged this from fetishdreams
    2. blahblechblarg reblogged this from cloudsofsoom and added:
      The rope keeping her toes in close isn’t necessary if the clamps are there.
    3. cloudsofsoom reblogged this from heretoenjoy
    4. idontrecallsayingporn reblogged this from bdsm and added:
      This looked horrifying at first but it looks like the rope does most of the work, so…
    5. somercet reblogged this from gorean-kajirus
    6. bound4fuun reblogged this from ilovelatex
    7. hidden-nemesys reblogged this from slavebarbara
    8. ilovelatex reblogged this from slavebarbara
    9. slavebarbara reblogged this from highwaygone
    10. highwaygone reblogged this from gorean-kajirus
    11. gorean-kajirus reblogged this from bondage-tr and added:
      Good position for display when I have friends visit.
    12. naturalobs3ssion reblogged this from unnaturallybound
    13. donsenilo reblogged this from nuremanko
    14. nuremanko reblogged this from beautifulfetish
    15. xxtheusualsuspectxx reblogged this from mastertiger
    16. sweetperversity reblogged this from trainingmygirl
    17. bplay-inspire reblogged this from trainingmygirl
    18. charliefpg reblogged this from trainingmygirl
    19. trainingmygirl reblogged this from heretoenjoy and added:
      Oh, that looks very fun.
    20. heretoenjoy reblogged this from seeinglines
    21. pollitocxz reblogged this from mascheranera
    22. mascheranera reblogged this from akinkygent
    23. akinkygent reblogged this from bdsm
    24. xshevax reblogged this from bondagepets
    25. fetishandbdsmzone reblogged this from bdsm
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornofuckyeahstockingslabialoungekousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr