1. Notes: 1167 / 3 months ago  from fetish4 (originally from ridiculouslybeautiful)
    Bit of wrapping makes a present look so much nicer.

    Bit of wrapping makes a present look so much nicer.

     
  2. Notes

    1. girlsfxckpretty reblogged this from riika
    2. wlesfemmes reblogged this from dailyporno
    3. nostalgicfag reblogged this from riah-chu
    4. homicidalsatan reblogged this from riah-chu
    5. rainbowslowpoke reblogged this from riah-chu
    6. riah-chu reblogged this from obtainwhatyoudesire
    7. getthemwhiletheyarehot reblogged this from loveisnothingmorethananaction
    8. obtainwhatyoudesire reblogged this from riika
    9. loveisnothingmorethananaction reblogged this from riika
    10. krystal-always reblogged this from riika
    11. riika reblogged this from slutyyvirgin
    12. howdoulikemyufo reblogged this from ganjachick
    13. ganjachick reblogged this from nudityisnatural
    14. eropantsu reblogged this from fuckyeahomanko
    15. penisenvoy reblogged this from lafemmedeviant
    16. potandskating420 reblogged this from nudityisnatural
    17. theblueseablues reblogged this from nudityisnatural
    18. nudityisnatural reblogged this from kinkypedia
    19. reiayanami0001 reblogged this from fuckyeahomanko
    20. fuckyeahomanko reblogged this from youngsexyskinny
    21. internetseinventoparaesto reblogged this from tri7
    22. hiperestesiavisual reblogged this from lajuventudperdida
    23. girlskissingfan reblogged this from dailyporno
    24. slutyyvirgin reblogged this from filthyfancy
    25. alamalditasea reblogged this from fuckya82
    26. boba-fetttish reblogged this from missislaveblog
    27. rainbowkandy reblogged this from ipostepicshit
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornokousokufuckyeahstockingslabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr