1. Notes: 84 / 3 months ago  from workaholicatrest (originally from lustfulkitty)
    workaholicatrest: Implied Threesome -Mr. Eckhoff caught them in the back of the science room. She didn’t even flinch. She just let her warm pussy get eaten. He only resisted a few meager minutes before he joined in.

    workaholicatrest:

    Implied Threesome

    -Mr. Eckhoff caught them in the back of the science room. She didn’t even flinch. She just let her warm pussy get eaten. He only resisted a few meager minutes before he joined in.

    (Source: lustfulkitty)

     

  2. Notes

    1. brainnotes reblogged this from bigjaysfavs
    2. fablesdelacomtesse reblogged this from pron4all
    3. agreaterlust reblogged this from pron4all
    4. delightfulurges reblogged this from pron4all
    5. sealteamsex reblogged this from pron4all
    6. xolostmindxo reblogged this from pron4all
    7. pron4all reblogged this from bigjaysfavs
    8. hiding4u reblogged this from pron4all
    9. bigjaysfavs reblogged this from workaholicatrest
    10. workaholicatrest reblogged this from lustfulkitty and added:
      Implied Threesome -Mr. Eckhoff caught them in the back of the science room. She didn’t even flinch. She just let her...
    11. borntolose-livetowin reblogged this from rntaddict
    12. rntaddict reblogged this from uniuma
    13. uniuma reblogged this from lustfulkitty
    14. gleballs reblogged this from ilovefun01
    15. storymansland reblogged this from ilovefun01 and added:
      Good girls do their homework together
    16. ilovefun01 reblogged this from mynervousmind
    17. quirkysubguy reblogged this from lustfulkitty
    18. cortejonu reblogged this from lustfulkitty
    19. cilla7x reblogged this from lustfulkitty
    20. f-nbeautiful reblogged this from lustfulkitty
    21. la-la-lesbians reblogged this from rawchina
    22. mynervousmind reblogged this from ffmftw
    23. ffmftw reblogged this from thesecretsbegin
    24. sex-fun-and-otherthings reblogged this from lustfulkitty
    25. sexfriendslove reblogged this from lustisa4letterword
    26. kitties-and-tittes reblogged this from lustfulkitty
    27. kiss-my-crown-jewels reblogged this from lustfulkitty
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokulabialoungefuckyeahstockingsdailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr