1. Notes: 174 / 3 months ago  from shinyretrostingy (originally from hotkinkycoupleuk-deactivated201)
    That’s a fun piercing. likeabikeseat: what’s that I said earlier about how in the future every whore will be pierced?  I meant this, too. hotkinkycoupleuk: Ouch!

    That’s a fun piercing.

    likeabikeseat:

    what’s that I said earlier about how in the future every whore will be pierced?  I meant this, too.

    hotkinkycoupleuk:

    Ouch!

     

  2. Notes

    1. workmeover reblogged this from hoolordilove
    2. hoolordilove reblogged this from holyfuuu
    3. brookemftw reblogged this from pizzashit
    4. holyfuuu reblogged this from pizzashit
    5. pizzashit reblogged this from baiorensu
    6. baiorensu reblogged this from eclecticpool
    7. telepathicbeelzebuth reblogged this from likeabikeseat
    8. eclecticpool reblogged this from telepathicbeelzebuth
    9. thefaplodge reblogged this from mypiercingstuff
    10. attitudeofservitude reblogged this from mypiercingstuff
    11. harley666 reblogged this from mypiercingstuff
    12. mypiercingstuff reblogged this from lordspooner
    13. mrmrswoodman reblogged this from metaldownthere
    14. sweatlips reblogged this from femdomhotwifecuckoldinterracial
    15. hotcplmeandshe reblogged this from femdomhotwifecuckoldinterracial
    16. kindheartedsadisticbastard reblogged this from bigjaysfavs
    17. belkeris reblogged this from dark-side-of-my-fantasies
    18. virginsextaboo reblogged this from dark-side-of-my-fantasies
    19. only-pussys-and-cocks reblogged this from dark-side-of-my-fantasies
    20. dark-side-of-my-fantasies reblogged this from femdomhotwifecuckoldinterracial
    21. k9trainer reblogged this from bigjaysfavs
    22. bigjaysfavs reblogged this from shinyretrostingy and added:
      That’s a fun piercing.
    23. serendipityslave reblogged this from contradictarycomplimentary and added:
      similar to the labia spreader girl uses
    24. sexsymbols reblogged this from femdomhotwifecuckoldinterracial
    25. sexswitch reblogged this from shinyretrostingy
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungekousokudailypornofuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr