1. Notes: 142 / 1 year ago  from harlette (originally from sexybondage)
    Lovely tits for caning
harlette:

The secondary benifits working at this farm are great. It has boobs and you can fuck it. Best to do her first thing in the morning though, by the end of the morning she’s just sloppy.

    Lovely tits for caning

    harlette:

    The secondary benifits working at this farm are great. It has boobs and you can fuck it. Best to do her first thing in the morning though, by the end of the morning she’s just sloppy.

     
  2. Notes

    1. castratrix reblogged this from humanpony
    2. oddandkinky reblogged this from humanpony
    3. trapsandtrimmings reblogged this from humanpony
    4. lovesharkbaby reblogged this from sexybondage
    5. roughlysex reblogged this from sexybondage
    6. cutepits reblogged this from armsuphigh
    7. kotutavsan reblogged this from harlette and added:
      Sometimes I really miss
    8. bigjaysfavs reblogged this from harlette and added:
      Lovely tits for caning
    9. harlette reblogged this from bdsm and added:
      The secondary benifits working at this farm are great. It has boobs and you can fuck it. Best to do her first thing in...
    10. thedeviousmoose reblogged this from mind-effing
    11. porndepot reblogged this from hedonistparadise
    12. continentl reblogged this from mind-effing
    13. armsuphigh reblogged this from bouba
    14. pervyprincess reblogged this from mm12
    15. sistersinthefront reblogged this from runawayerotica
    16. jeteveuxcommeca reblogged this from thingsiddotoyou and added:
      Someone has been really bad… Payback’s a bitch !
    17. despairs reblogged this from thingsiddotoyou
    18. idrisveitch reblogged this from thingsiddotoyou
    19. mm12 reblogged this from thingsiddotoyou
    20. shide reblogged this from thingsiddotoyou
    21. thingsiddotoyou reblogged this from humanpony
    22. onyxcage reblogged this from humanpony
    23. humanpony reblogged this from daisysub
    24. masterfaith reblogged this from daisysub
    25. daisysub reblogged this from farmd0g and added:
      Nothing like new stock to break in. She’s got so much to learn. It’s going to take a firm hand, but she’ll be worth the...
    26. rawfusion reblogged this from hedonistparadise
    27. singlehandedly reblogged this from hedonistparadise
    28. mind-effing reblogged this from uniquetrouble
    29. nextcape reblogged this from ropebondage
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokufuckyeahstockingslabialoungedailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr