1. Notes: 54 / 2 years ago  from wanderer-of-dark-dreams (originally from sandyb77)
    An don’t spill a drop! wanderer-of-dark-dreams: (via sandyb77)

    An don’t spill a drop!

    wanderer-of-dark-dreams:

    (via sandyb77)

     

  2. Notes

    1. celticorca reblogged this from sweetsurrenders
    2. ineedyoukinkylove reblogged this from sweetsurrenders
    3. sweetsurrenders reblogged this from uniquetrouble
    4. uniquetrouble reblogged this from papiersgras
    5. dtnhbd reblogged this from wanderer-of-dark-dreams and added:
      stay very very still
    6. heathen-pleasures reblogged this from bigjaysfavs
    7. bigjaysfavs reblogged this from wanderer-of-dark-dreams and added:
      An don’t spill a drop!
    8. whoreably-ruined reblogged this from papiersgras
    9. papiersgras reblogged this from faiteslamour1
    10. shaggedbyarareparrot reblogged this from wanderer-of-dark-dreams
    11. taroid5 reblogged this from wanderer-of-dark-dreams
    12. quickienewyork reblogged this from wanderer-of-dark-dreams
    13. wanderer-of-dark-dreams reblogged this from sandyb77
    14. sandyb77 posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornofuckyeahstockingslabialoungekousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr