1. Notes: 78 / 1 year ago  from mywifetheslut (originally from wordoyster)
    I wonder what’s the story here. Does she look that disgusted because the ballgag clashes with her lipstick? Is he going to force it in anyway? Or show a few others untill she looks happy?
mywifetheslut:

    I wonder what’s the story here. Does she look that disgusted because the ballgag clashes with her lipstick? Is he going to force it in anyway? Or show a few others untill she looks happy?

    mywifetheslut:

     
  2. Notes

    1. omgrestraints reblogged this from cloudsofsoom
    2. ladybitz reblogged this from themephistos
    3. desertwolfaz reblogged this from blackfryar
    4. blackfryar reblogged this from themephistos and added:
      It will ruin her lipsick…..but she
    5. themephistos reblogged this from cloudsofsoom
    6. cloudsofsoom reblogged this from and added:
      She will take it
    7. lausberger reblogged this from ropesncuffs
    8. gaynorsgloriousgags reblogged this from tastefulbondage
    9. surwheel reblogged this from dr-tarl
    10. tastefulbondage reblogged this from ropesncuffs
    11. romanticanimal reblogged this from donebutwitherrorsonpage
    12. truedomination reblogged this from donebutwitherrorsonpage
    13. donebutwitherrorsonpage reblogged this from leciteen and added:
      Beauty is in the eye…
    14. ropesncuffs reblogged this from leciteen
    15. gunmetaldevil reblogged this from thecollaredlady
    16. thecollaredlady reblogged this from libertinelover
    17. libertinelover reblogged this from swisssublover and added:
      Travels of a harlot A present for my intern from me.She’s obviously choked up with excitement that her boss and mistress...
    18. leciteen reblogged this from chaingirl
    19. elegantdominance reblogged this from chaingirl
    20. chaingirl reblogged this from swisssublover
    21. pampussy reblogged this from swisssublover and added:
      Should become the gagball like this sub slut @PamPussy
    22. swisssublover reblogged this from warichnicht
    23. warichnicht reblogged this from auspeitscher
    24. auspeitscher reblogged this from mylessthanvanilla
    25. mylessthanvanilla reblogged this from themephistos
    26. themephistos reblogged this from farmd0g
    27. pussyisaprivilege reblogged this from somefetishes
    28. vysoven reblogged this from vicious-rumors
    29. vicious-rumors reblogged this from fetish4 and added:
      I wonder what’s the story here. Does she look that disgusted because the ballgag clashes with her lipstick? Is he going...
    30. somefetishes reblogged this from fetish4
    31. sin260 reblogged this from fetish4
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

fetish4dailypornodaddysbrokengirlslaveshousedtnhbdakinkygentropebondagechilxsomefetishesvisualfetishwiscomankinkydaylingerie-lovedownherthroatbdsmsubselfbondagedreamfuckyeahballgagskneel4himaltpornsexnotsexshinyretrostingytrussedmodfetishshinoatdarkcumdollsimplewishescanipleasecum-sircuriously-shy-slutfuckyeahbuttplugsvoluntarytourettesawesomegapesandanalinsertionslabialoungeworkaholicatrestpuppyslutmariafuckyeahstockingsbytheladybackseamextremestaffaryehpridexxxtoonsxxxmind-effingpicmanbdsmart-or-pornundercoverkinkstergretchenmusingsthedirtysideantiquerestdonebutwitherrorsonpagehisownedwifepainslutxlordschufterasedmapkinkrealashleyreneefluffyropesfuckyeahfrenchmaidsbondagebunnyvysovenfitandfetishmywifetheslutdiaryofasubfreakecstasyinrestraintslibraryvixendanaewhisperingtsypkindontyoufuckingmovekneelbegcrawlsoupergirlorgasmgivrdementedkittenbdsm69anothersecretfetishpolaritiesnettersklavenylonfoxietransformherbendmeoverohyeahhardernomdegsmutilovebendingsubmissionstrictworldariannaacquiescesgingerbellesbedroombighappyfacespankablemaidstaroid5kousokusluttybunnylikeabikeseatthingsiddotoyouslavepetsfuck-n-fight-clubdddecembercollaredprincess333imageslostlittlesubsubmissivenikkibiffjr99wearegoingtohellplayswithdollsyesdaddybrattytrampsmaster667ninaninetakinkamateursslavegardencabernetsauvignonfuckmakernymphomaniac-fantasiamr-sinfernanalslaveellienaughtycinderellanickthedickreloadedzebraspornfreckyeahfucklesmaedchen-in-uniformartofpornbarcodedbitchelizajaneblackfuckyouredheadskindlybeatingheriambic9dollkinkythesophisticatedslutcontrolstolzewhips-and-chains-make-me-excitedfaye6sashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsjstbdsmmarkdezantscandalouswenchfuckimsorryeditorforaweekplaythepianonakedtroisiemebringonxtoysashadymotelinthedesertscepticslutheadswim
 

Tumblr