1. Notes: 218 / 1 year ago  from slutbutter-deactivated20111209 (originally from unnaturallybound)
    Cute and very good use of a tongue piercing.
slutbutter:

Never tried that with the tongue piercing. i kind of want it back now.

    Cute and very good use of a tongue piercing.

    slutbutter:

    Never tried that with the tongue piercing. i kind of want it back now.

     
  2. Notes

    1. hahrdkawr reblogged this from piercednipples
    2. mr-travisty reblogged this from unnaturallybound
    3. allsexisbeautiful reblogged this from alternativesexual
    4. bound4fuun reblogged this from piercednipples
    5. ed2k reblogged this from fratzenbuch
    6. xarcado reblogged this from foreverluvdarkbaby and added:
      //xarcado.tumblr.com
    7. alternativesexual reblogged this from robstoughts
    8. ironyinvades reblogged this from cumfordaddy and added:
      Whaaa??? This is awesome. I want my nipple rings back. And i might need a tongue ring too…
    9. wfeather reblogged this from mylessthanvanilla
    10. mylessthanvanilla reblogged this from cumfordaddy
    11. 5exy-5adie reblogged this from cumfordaddy
    12. fetishsm reblogged this from cumfordaddy
    13. cddragon reblogged this from teamspankortank
    14. cumfordaddy reblogged this from teamspankortank
    15. teamspankortank reblogged this from robstoughts
    16. robstoughts reblogged this from everydaycollars
    17. msdmsd reblogged this from niplove
    18. perfectoman reblogged this from niplove
    19. niplove reblogged this from everydaycollars
    20. fratzenbuch reblogged this from everydaycollars
    21. everydaycollars reblogged this from swingtastic
    22. boston-kinkster reblogged this from submissivenikki
    23. chicksgirls reblogged this from pervertssex
    24. playinghotsex reblogged this from ddesire74
    25. lostabuttonhole reblogged this from priapismus
    26. priapismus reblogged this from unnaturallybound
    27. pervertssex reblogged this from ddesire74
    28. sexplaying reblogged this from ddesire74
    29. spankatronic reblogged this from piercednipples
    30. sexytogirlsoof reblogged this from ddesire74
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungefuckyeahstockingsdailypornokousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr