1. Notes: 225 / 2 years ago  from fetish4 (originally from suicideblonde)
    Oops, did I forget my skirt AGAIN?
fetish4:

caseyneiba:

goodmission:

suicideblonde:

Nadja Auermann photographed by Helmut Newton

    Oops, did I forget my skirt AGAIN?

    fetish4:

    caseyneiba:

    goodmission:

    suicideblonde:

    Nadja Auermann photographed by Helmut Newton

     
  2. Notes

    1. hedoneerotike reblogged this from naggisch
    2. ob-s-e-s-s-i-o-n reblogged this from thereissomethingabout
    3. prettydiariesofkeysha reblogged this from sexyclothes
    4. fuckyeahgirlsingarters reblogged this from fuckyeahgarters
    5. cristiandorm reblogged this from naggisch
    6. lacigaleetlafourmi reblogged this from molekul
    7. molekul reblogged this from naggisch
    8. seanquixote reblogged this from erwinromulo
    9. whatareyourclothessayingtoday reblogged this from inmym1nd and added:
      emlékeim szerint ez egy Blumarine kampány volt
    10. lindsburger reblogged this from amysticvelvet
    11. paris2london reblogged this from amysticvelvet
    12. pigfatliar reblogged this from amysticvelvet
    13. loopdeville reblogged this from suicideblonde
    14. pukeathon reblogged this from zialikeshotbroads
    15. zialikeshotbroads reblogged this from chicks-man
    16. chicks-man reblogged this from fetish4
    17. curvesinthedark reblogged this from fetish4
    18. theoria-et-praxis reblogged this from highheel
    19. miumachi reblogged this from pillow-book
    20. bigjaysfavs reblogged this from fetish4 and added:
      Oops, did I forget my skirt AGAIN?
    21. robertfilmer reblogged this from highheel
    22. leozukov reblogged this from nonrev
    23. nonrev reblogged this from pinkprincess17
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornokousokufuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr