1. Notes: 69 / 1 year ago  from chilx (originally from bdsm69)
    Nice set of ponies

    Nice set of ponies

     

  2. Notes

    1. glossy-couple reblogged this from humanpony
    2. mindviolations reblogged this from humanpony
    3. southerncross666 reblogged this from mwmbound
    4. zmilesaway reblogged this from mwmbound
    5. oddandkinky reblogged this from humanpony
    6. sieurdeon reblogged this from humanpony
    7. formsforms reblogged this from knowwhatyouwant
    8. girlsnotice reblogged this from humanpony
    9. deepperversion reblogged this from sexpositivesissy and added:
      a wonderful matched pair
    10. dstalingrad3333 reblogged this from humanpony
    11. mrw747 reblogged this from humanpony
    12. theatomichand reblogged this from mwmbound
    13. sexpositivesissy reblogged this from humanpony
    14. knowwhatyouwant reblogged this from humanpony
    15. kramkiste reblogged this from humanpony
    16. humanpony reblogged this from mwmbound
    17. shaggingagenda reblogged this from sweatspitcumglitterandbruises
    18. lukemonaco reblogged this from undercoverkinkster
    19. undercoverkinkster reblogged this from bdsm69
    20. mrxfantasyworld reblogged this from shinyretrostingy
    21. mwmbound reblogged this from bdsm69 and added:
      love the chastized pony girls!
    22. sweatspitcumglitterandbruises reblogged this from naggisch and added:
      together now girls…
    23. masterandkitten reblogged this from shinyretrostingy and added:
      Marching in time
    24. naggisch reblogged this from shinyretrostingy
    25. shinyretrostingy reblogged this from bdsm69
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterfuckyeahstockingsdailypornokousokulabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr