1. Notes: 27 / 3 years ago  from dolldressed (originally from sellw-deactivated20120202)
    Yeah, bend her over the desk!

    Yeah, bend her over the desk!

     
  2. Notes

    1. russiannuclearcodes reblogged this from bigjaysfavs
    2. hisbabygirldreams reblogged this from bigjaysfavs
    3. hind-sight reblogged this from ella9
    4. bigjaysfavs reblogged this from dolldressed and added:
      Yeah, bend her over the desk!
    5. dolldressed reblogged this from namsajang
    6. dirtylittlefreakshow reblogged this from simply-black-and-white
    7. stupiddumbjerk reblogged this from simply-black-and-white
    8. dontfollowmeimlosttoo reblogged this from ella9
    9. ilisten2u2 reblogged this from cristania
    10. pre2pre reblogged this from ella9
    11. simply-black-and-white reblogged this from ella9
    12. jardindelsatiro reblogged this from ella9
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

fetish4ffncollectorjaythegremlinacademyfordifficultgirlsworkaholicatrestsensualhumiliationgenre-bdsm-kinkyhotlatexoutfitsdailypornoropebondagejustnippleclampstsypkinsubmissive-monarchpainslutxeverydaycollarsakinkygentbondagedreamsuckitbimbolabialoungetheporcelainlakecreamfacestrooper505mm-happyxxxtoonsxxxchilxgirlswhoswallownankingdecadebasetliensfitandfetishrealashleyreneedoyoulikethat-slutantiquerestnaughtycinderellakindlybeatingherher-masterdumbbigtittedslutmind-effingbendmeovergaggedandforeverboundsluttybunnylacemearyehprideerasedmapgettingbusyintheofficesubmissivegingerpicmanbdsmecstasyinrestraintsmarriedbutherestaffhourglass-silhouettejoinmilehighclubstrictworldbimbosminderstewardessesandassortedothersaltpornbondageloveraslikeasshappybdsmdr-tarlkinkydaylipstixxxfuckyeahfrenchmaidsheeladvisedslaveshousenettersklavemochavanillalattesainttriniansdeepanaldildoawesomegapesandanalinsertionsmywifetheslutfaye6analmom69shinyretrostingysadisticgameslibraryvixendonebutwitherrorsonpagebdsmalexintheaisledollkinkybdsm69vysovenglovedandboundfuckyeahanalfacelightworshipgretchenmusingsslavetrainingsbighappyfacefetishweeklyfap-labsexnotsexfemaledenialkousokuwearegoingtohellsomefetishesanothersecretfetishnightsmutonly-secretariesmaxlatenslavegardensoupergirltaroid5boundballetfuckyeahbuttplugspuppygirlsnplaythingspeselectrotocamusicabendingsubmissionair-tripfacesofanalthetamingofaslutcuriously-shy-slutnomdegschoolgirlsonwoodstairsgaggedkissingjstbdsmsubmissivenikkifuckmakerslavepetschloecumslutindetentiondtnhbddiederiqsmaidsthe-mouth-of-the-goddesskneelbegcrawlbackseamextremewanderer-of-dark-dreamskneel4himsmaster667daddysbrokengirlheathen-pleasuresfuckyeahballgagsgingerbellesbedroomsubjuanitaninaninetafuck-n-fight-clubnylonfoxielostlittlesubropeculturebiffjr99infernanalfilthyzensoredstuffitinmemodfetishyesdaddyrapedollieangelinadanaewhisperingonly-ball-gagstransformhersimplewishesdementedkittenmr-s000-xxxthingsiddotoyouslaveelliesundash22fluffyropesundercoverkinksterpigtailprincesstroisiemebringonxtoyspolaritiessmutilovepony-girl-elisa-solonsdottirfetishphotosshinoatdarkalittlespicyiambic9sunnycuntdoorstomanualnametobedeterminedariannaacquiescesvoluntarytourettesnymphomaniac-fantasiaeditorforaweekcollaredprincesscabernetsauvignonzebraspornartofpornbarcodedbitchthesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreyharlettedaisysubdolldressedvisitingsodomfeckfeckfeckfrenchmaidsweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr