1. Notes: 48 / 2 years ago 
     

  2. Notes

    1. sinner-in-a-saints-world reblogged this from slaveshouse
    2. johnnynoir reblogged this from fdoll
    3. fdoll reblogged this from likeabikeseat
    4. tplayer reblogged this from likeabikeseat
    5. likeabikeseat reblogged this from slaveellie and added:
      I love the thick cane and her odd little asshole. pretty.
    6. slaveellie reblogged this from ninanineta
    7. ninanineta reblogged this from shinyretrostingy and added:
      My new obsession…so intrigued and aroused by the idea… ~Nina
    8. shinyretrostingy reblogged this from slaveellie
    9. luvs2duit reblogged this from reallydirtythings and added:
      Naughty Sasha……bad girl…..
    10. reallydirtythings reblogged this from thrushbone
    11. assandholes reblogged this from unapplez
    12. unapplez reblogged this from secretagentslut
    13. erectus reblogged this from secretagentslut
    14. lacigaleetlafourmi reblogged this from thrushbone
    15. thrushbone reblogged this from gh2u
    16. mirrormaskcamera reblogged this from gh2u
    17. sin260 reblogged this from gh2u
    18. gh2u reblogged this from secretagentslut
    19. butts-n-buttholes reblogged this from secretagentslut
    20. ropebondage reblogged this from bigjaysfavs
    21. bigjaysfavs posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornokousokufuckyeahstockingslabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr