1. Notes: 49 / 4 years ago  from fuckyeahbuttplugs
    Dildo panties?
(via fuckyeahbuttplugs)

    Dildo panties?

    (via fuckyeahbuttplugs)

     
  2. Notes

    1. ukwildcatcelticmaster reblogged this from fuckyeahbuttplugs and added:
      (via fuckyeahbuttplugs)
    2. quirkysubguy reblogged this from butt-sex and added:
      (via butt-sex, fuckyeahbuttplugs)
    3. thebestofnsfw reblogged this from anonymousw and added:
      (via anonymousw, fuckyeahbuttplugs)
    4. smutroll reblogged this from fuckyeahbuttplugs and added:
      (via fuckyeahbuttplugs)
    5. sexsex7 reblogged this from butt-sex and added:
      "look! no hands!" (via butt-sex, fuckyeahbuttplugs)
    6. milforiffic reblogged this from sweetsurrenders
    7. sweetsurrenders reblogged this from fuckyeahbuttplugs and added:
      (via fuckyeahbuttplugs)
    8. recycle12 reblogged this from flanderz
    9. flanderz reblogged this from butt-sex and added:
      (via butt-sex, fuckyeahbuttplugs)
    10. butt-sex reblogged this from fuckyeahbuttplugs
    11. isht reblogged this from fuckyeahbuttplugs and added:
      (via fuckyeahbuttplugs)
    12. bigjaysfavs reblogged this from fuckyeahbuttplugs and added:
      Dildo panties? (via fuckyeahbuttplugs)
    13. mexpongodesnudo reblogged this from fuckyeahbuttplugs and added:
      (via fuckyeahbuttplugs)
    14. anonymousw reblogged this from fuckyeahbuttplugs
    15. fuckyeahbuttplugs posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

hotlatexoutfitsgretchenmusingsropebondagejustnippleclampsstewardessesandassortedothersboundballettsypkinsubmissive-monarchjaythegremlindailypornoworkaholicatresteverydaycollarssmaster667fetish4akinkygentpainslutxsensualhumiliationlabialoungemaxlatenanothersecretfetishcreamfacesxxxtoonsxxxstrictworldnastynymphoslutsgirlswhoswallowgenre-bdsm-kinkysadisticgamesffncollectorfitandfetishmm-happyem56lightworshiptransformhernankingdecadetrooper505bondageloverher-masterdr-tarlmind-effingsuckitbimbokindlybeatinghermochavanillalattefetishweeklynightsmutpicmanbdsmgettingbusyintheofficelacemefuckmakerrealashleyreneehourglass-silhouettesomefetishesjoinmilehighclubcuriously-shy-slutschoolgirlsonwoodstairsfemaledenialmarriedbutherealtpornlipstixxxanalmom69alexintheaisleerasedmapfelixdartmouthdumbbigtittedslutnettersklavevysovenslavetrainingsacademyfordifficultgirlsmywifethesluttheporcelainlakediederiqsmaidsthetamingofabeastkinkydaychilxdoyoulikethat-slutmodfetishecstasyinrestraintssubmissivegingerheeladvisedantiquerestlibraryvixennomdegaslikeassfuckyeahanalfacefuckyeahbuttplugspeselectrobimbosminderawesomegapesandanalinsertionsstaffdeepanaldildoslaveshousehappybdsminfernanalglovedandboundbendingsubmissionsexnotsexbdsmjstbdsmgaggedandforeverboundmymilkweedindetentiondollkinkynaughtycinderellachloecumslutsainttriniansbdsm69air-tripslavegardenslavepetsdonebutwitherrorsonpagekousokubasetliensbendmeoverfap-labheathen-pleasuresfuckyeahfrenchmaidsfuckyeahballgagsfaye6only-secretariesgingerbellesbedroomsluttybunnywanderer-of-dark-dreamssubmissivenikkibackseamextremefacesofanaltaroid5shinyretrostingybiffjr99bondagedreamgaggedkissinghot-uniform-milfpuppygirlsnplaythingssoupergirlaryehpridebighappyfacewearegoingtohelltocamusicadtnhbdthe-mouth-of-the-goddesskneelbegcrawlkneel4himdaddysbrokengirlsubjuanitaninaninetafuck-n-fight-clubnylonfoxielostlittlesubropeculturestuffitinmeyesdaddyrapedollieangelinadanaewhisperingonly-ball-gagssimplewishesdementedkittenmr-s000-xxxthingsiddotoyouslaveelliesundash22fluffyropesundercoverkinksterpigtailprincesstroisiemebringonxtoyspolaritiessmutilovefetishphotosshinoatdarkalittlespicyiambic9sunnycuntdoorstomanualnametobedeterminedariannaacquiescesvoluntarytourettesnymphomaniac-fantasiaeditorforaweekcollaredprincesscabernetsauvignonzebraspornartofpornbarcodedbitchthesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreyharlettedaisysubdolldressedvisitingsodomfeckfeckfeckfrenchmaidsweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr