1. Notes: 128 / 10 months ago  from shinyretrostingy (originally from latexthing)
    Ballet boot training

    Ballet boot training

     
  2. Notes

    1. glossy-couple reblogged this from themephistos
    2. surrenderisland reblogged this from taylahmaid and added:
      tina didn’t mind teaching Master’s new slave how...properly walk in His preferred boots....
    3. stoneys22 reblogged this from ilovelatex
    4. pinkshawnasteel reblogged this from latexthing
    5. toejamtom reblogged this from fakerockchick
    6. whgreiner reblogged this from extra-latex
    7. wolfonabridge reblogged this from sissychristie
    8. sissychristie reblogged this from bootfetish
    9. bootfetish reblogged this from latexcatsuit
    10. fakerockchick reblogged this from latexcatsuit
    11. krystinerenee reblogged this from fakerockchick
    12. reistorm reblogged this from extra-latex
    13. clilly1 reblogged this from evilblackbloodyangel
    14. evilblackbloodyangel reblogged this from latexcatsuit
    15. latexcatsuit reblogged this from extra-latex
    16. nevershould reblogged this from janiel
    17. janiel reblogged this from extra-latex
    18. extra-latex reblogged this from lubberyrove
    19. lubberyrove reblogged this from ilovelatex
    20. checkthechicks reblogged this from ilovelatex
    21. ilovelatex reblogged this from welshd and added:
      Where can i get me some of those see through boots!?
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterlabialoungedailypornofuckyeahstockingskousokualtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr