1. Notes: 42 / 1 year ago  from harlette (originally from faye6)
    I love your thinking. But isn’t this another “foot-in-mouth” case? harlette: Are those clamps attached to the wall? If not, they should be. Great place to put her when you don’t need her. Or to whip her. I guarantee you she won’t be jumping up and down. (via faye6)

    I love your thinking. But isn’t this another “foot-in-mouth” case?

    harlette:

    Are those clamps attached to the wall? If not, they should be. Great place to put her when you don’t need her. Or to whip her. I guarantee you she won’t be jumping up and down.

    (via faye6)

     

  2. Notes

    1. whippinggirl reblogged this from slaveshouse
    2. papasan reblogged this from slaveshouse
    3. panincubus reblogged this from harlette and added:
      Wonderfully wicked… harlette:
    4. johnnynoir reblogged this from slaveellie
    5. slaveellie reblogged this from harlette
    6. mywifetheslut reblogged this from nickthedickreloaded and added:
      Fantastic! I wish I could find those somewhere around here..
    7. bigjaysfavs reblogged this from harlette and added:
      love your thinking. But isn’t this another “foot-in-mouth” case?
    8. harlette reblogged this from likeabikeseat and added:
      Are those clamps attached to...wall? If not, they should be. Great place to put
    9. bingo-bongo reblogged this from likeabikeseat
    10. likeabikeseat reblogged this from faye6
    11. hot-touch reblogged this from naggisch
    12. naggisch reblogged this from nickthedickreloaded
    13. sin260 reblogged this from slaveshouse
    14. lacigaleetlafourmi reblogged this from nickthedickreloaded
    15. nickthedickreloaded reblogged this from slaveshouse
    16. slaveshouse reblogged this from secretagentslut
    17. quome reblogged this from faye6
    18. zets reblogged this from faye6
    19. expansivelust reblogged this from faye6
    20. egoista reblogged this from faye6
    21. faye6 posted this
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornokousokulabialoungefuckyeahstockingsaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr