Posts tagged "ashley renee"
  1. Notes: 3 / 1 month ago  from bookmarklet
    Ashley in some lovely pink boots

    Ashley in some lovely pink boots

     
  2. Notes: 19 / 3 months ago  from shinyretrostingy (originally from wiscoman-deactivated20120222)
    Ashley makes a good maid

    Ashley makes a good maid

     
  3. Notes: 18 / 3 months ago  from akinkygent (originally from trussed)
    Not often you see Ashley with one of those gags

    Not often you see Ashley with one of those gags

    (Source: trussed)

     
  4. 4 months ago  from bookmarklet
    Ashley makes a wonderful secretary, especially over the knee!

    Ashley makes a wonderful secretary, especially over the knee!

     
  5. Notes: 213 / 8 months ago  from akinkygent (originally from wiscoman-deactivated20120222)
    Cumbucket at the ready!
wiscoman:

Turned out that, at this party anyway, “guest of honor” didn’t mean what she thought it meant.

    Cumbucket at the ready!

    wiscoman:

    Turned out that, at this party anyway, “guest of honor” didn’t mean what she thought it meant.

     
  6. Notes: 8 / 9 months ago  from realashleyrenee
    Ashley Renee: ASHLEY RENEE GOES HIGH DEFINITION!

    realashleyrenee:

    Yes, you heard it right! I’m going to give in and go all out with high definition videos. I finally threw my hands up and realized I’ll have to follow the crowd. I hope all this initial trouble is appreciated since it’s thrown my editor in a tailspin trying to make everything compatible. I…

    (Source: ashleyrenee.com)

  7. Notes: 12 / 9 months ago  from bookmarklet
     
  8. Notes: 14 / 11 months ago  from bookmarklet
    Except for a deep sigh, what can you say?

    Except for a deep sigh, what can you say?

     
  9. Notes: 110 / 1 year ago  from shinyretrostingy (originally from wiscoman-deactivated20120222)
    Very doable!

    Very doable!

     
  10. Notes: 30 / 1 year ago  from realashleyrenee
    Ashley Renee is always nice.

realashleyrenee:

A pic from archive in this week update, where I am enduring a strict corset, stockings and heavy chains. More available in my website. 
Click on the pic to get it full. 
xoxox

    Ashley Renee is always nice.

    realashleyrenee:

    A pic from archive in this week update, where I am enduring a strict corset, stockings and heavy chains. More available in my website

    Click on the pic to get it full. 

    xoxox

    (Source: ashleyrenee.com)

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterkousokulabialoungefuckyeahstockingsdailypornoaltpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsfetish4bondagebunnymywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr