Posts tagged "bondage"
  1. Notes: 102 / 2 days ago  from bndgelvr (originally from kanehoward)
    Seems cheap enough

    Seems cheap enough

    (Source: kanehoward)

     
  2. Notes: 97 / 3 days ago  from bndgelvr (originally from scentofslave)

    (Source: scentofslave)

     
  3. Notes: 67 / 3 weeks ago  from bookmarklet
    Sure does you good to get out in the fresh air

    Sure does you good to get out in the fresh air

     
  4. Notes: 68 / 4 weeks ago  from bendingsubmission (originally from awsm)
    Two good looking slavegirls, lucky bastard!

    Two good looking slavegirls, lucky bastard!

    (Source: awsm)

     
  5. Notes: 752 / 4 weeks ago  from chilx (originally from imagesofmydesire-deactivated201)
    My wife has a top just like that.

    My wife has a top just like that.

     
  6. Notes: 112 / 4 weeks ago  from chilx (originally from bondagelover)

    (Source: bondagelover)

     
  7. Notes: 4 / 4 weeks ago  from bookmarklet
    Smile!

    Smile!

     
  8. Notes: 1 / 1 month ago  from bookmarklet
     
  9. Notes: 6 / 1 month ago  from bookmarklet
    The hitachi just found the spot, moaning is not far away.

    The hitachi just found the spot, moaning is not far away.

     
  10. Notes: 15 / 1 month ago  from bookmarklet
    Cleaning it after use, it’s only proper

    Cleaning it after use, it’s only proper

     
avatar_128
 
 
I'm a 30-something dominant male married to a wonderful kinky and submissive wife.

On this blog I collect my favorite, mainly pornographic, often bondage or SM, sometimes erotic pictures from tumblr and other sources.

If it's here it's either because I think it's a great picture, very hot or both.

All pics are assumed to be in the public domain. Whenever possible I provide links back to the original source.

Copyright complaints, tips, indecent proposals and bribes via bigjaysfavs@gmail.com or via http://bigjaysfavs.tumblr.com/ask

 
 

Following

akinkygentbondagedreamchilxundercoverkinksterdailypornokousokufuckyeahstockingslabialoungealtpornsquidintestines333imageseverydaycollarskinkamateursfuckyeahballgagsbondagebunnyfetish4mywifetheslutnettersklavesexnotsexdasein0830somefetisheskindlybeatingherslaveelliebendingsubmissionxxxtoonsxxxlibraryvixenpainslutxbegginguntilicumtrussedworkaholicatrestmind-effingshinyretrostingygagbratfuckyeahanalfacepuppygirlsnplaythingsfuckyeahbuttplugskinkydaythedirtysidemodfetisharyehpridegingerbellesbedroomantiqueresthappybdsmkinkecstasyinrestraintscuriously-shy-slutfuckmakerfuckyeahfrenchmaidsdanaewhisperingohyeahharderbendmeoverdonebutwitherrorsonpagekneel4himstaffsubselferasedmapawesomegapesandanalinsertionsfaye6smutilovejstbdsmrealashleyreneeinfernanalstrictworldkneelbegcrawlslaveshousediaryofasubfreakgretchenmusingsgreynothingnessfitandfetishbdsmpicmanbdsmfuck-n-fight-clubwearegoingtohellnomdegthetamingoftheslutanothersecretfetishtsypkinfluffyropeshisownedwifedaddysbrokengirldementedkittensoupergirlsmaster667submissivenikkiyesdaddybdsm69ariannaacquiescesbytheladybiffjr99sluttybunnydontyoufuckingmovebackseamextremevysovenschoolgirlsonwoodstairsropebondagevisualfetishtaroid5dollkinkyelizajaneblacklordschuftvoluntarytourettesnickthedickreloadedslavepetssimplewishesninaninetalikeabikeseatspankablemaidsdtnhbdfreckyeahfucklesnylonfoxieeditorforaweekfuckyouredheadstroisiemeslavegardenbringonxtoyscollaredprincessnaughtycinderellapolaritiesshinoatdarkbighappyfaceorgasmgivrlostlittlesubnametobedeterminedalittlespicytransformherthingsiddotoyoudddecembercabernetsauvignonnymphomaniac-fantasiamr-szebraspornartofpornbarcodedbitchiambic9thesophisticatedslutwhips-and-chains-make-me-excitedsashafuckinggreywanderer-of-dark-dreamsharlettedaisysubdolldressedvisitingsodomfeckfeckfeckheathen-pleasuresweshoulddothisbrigiddommehi-heelsmarkdezantscandalouswenchfuckimsorryplaythepianonakedashadymotelinthedesertscepticslutheadswim
 

Tumblr